5B0O,5IK2,4NPH,3VR6,5SWJ,3J9T,2QE7,5BN3,3J9T,5BN3


Conserved Protein Domain Family
ATP-synt_ab

?
pfam00006: ATP-synt_ab 
Click on image for an interactive view with Cn3D
ATP synthase alpha/beta family, nucleotide-binding domain
This entry includes the ATP synthase alpha and beta subunits, the ATP synthase associated with flagella and the termination factor Rho.
Statistics
?
PSSM-Id: 333759
View PSSM: pfam00006
Aligned: 507 rows
Threshold Bit Score: 174.825
Threshold Setting Gi: 124460788
Created: 13-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5B0O_A       162 GVRAINALLTVGRGQRMGLFAGSGVGKSVLL----GMMARYt-rADvIVV-GLIGERGREVKDFIENILGPDGRARSVVI 235 Salmonella ente...
Q4A5U8       125 GIKAIDFFVPIFEGDKIGIFGGAGVGKTVLMkeiiFNLSKQk--ENtSAIfIGSGERSREAIELYNDLSESNLMKNSVMY 202 Mycoplasma syno...
Q4A9L0        96 GIKALDFFVPIFEGYKIGIFGGAGVGKTVLMkeiiFNVSKQr--QKvSSIfVGSGERSREGLELFLELKESNLMAKSTMF 173 Mycoplasma hyop...
Q7NAJ3       127 GIKAIDFFMPILKGHNLGILGGAGVGKTVLMkeiiFNSSRSnsaKKnSSIfIGSGERSREGVELYQELEQSNLMKDSMMF 206 Mycoplasma gall...
CRH24475      53 GIKAIDFFIPIIKGFKLGIFGGAGVGKTVLMkeiiFNVNKDk--KSiSNIfIGSGERSREAIELFNELESSNLMKNSSMY 130 Chlamydia trach...
WP_013054227 127 GIKVIDFFIPIFKGYKLGIFGGAGVGKTVLMkeiiFNTLKQn--NTdSSIfIGSGERSREGIELYEELINSKLMNNSMMF 204 Mycoplasma croc...
WP_012498277 125 GIKAIDFFMPILKGYKLGIYGGAGVGKTVLMkeiiFNINKNi--KDsSSIfIGSGERSREGIELYEELEKSNLMQNSTIF 202 Mycoplasma arth...
CDD56548     126 GIKVLDFFAPMRKGFKMGLLGGAGVGKTVLIkeliHNVYQG---LGsNSVfIGVGERSREGRELYDEMTEAGLLDKMAMV 202 Clostridium sp....
CCY89042     127 GIKVIDFFTPIAKGFKMGLLGGAGVGKTVLVkeliNNIYKR---LNsNAVfIGVGERSREGKELIDEMASSNLLDKMSIV 203 Mycoplasma sp. ...
CDE95046     126 GIKVIDFFAPLQKGFKMGLLGGAGVGKTVLIkeliHNVYSS---INaHAIfVGAGERSREGKELYDDMLESNLLDKMVMV 202 Clostridium sp....
5B0O_A       236 AAPADVSPLLRMQGAAYATRIAEDFRD-RGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERAGN 314 Salmonella ente...
Q4A5U8       203 VSRMNENPGARMSIVPVGITAAEYLRDnNKENVLLFIDNIFRFLQAGNEVAASLDKKPSIGGYQATLNTEISQAEQRLFN 282 Mycoplasma syno...
Q4A9L0       174 VAQMNETPGARSMIVPMGVTAAEYARDyEKEDVLLFIDNIYRFIQATNEVSSALEKNVSIGGYHATMASDVAFIQDRLFK 253 Mycoplasma hyop...
Q7NAJ3       207 ISKMDEPPGARMSIVPYGITAAEYLRDvEKEDVLLFIDNIFRFIQAGNEVAPGLNKKPITGGYQATLDTEVSNVEDRLYA 286 Mycoplasma gall...
CRH24475     131 ISKMNESPGARMSIVPIGITAAEYLRDyEKEDVLLFIDNIYRFVQAENEVSASLGKKPSVGGYQSTLDSDVASVQERLFK 210 Chlamydia trach...
WP_013054227 205 ISKMNESPGARMNIVPIGITSAEYLRDiQRENVLLFIDNIYRYIQAGNEASASLGKKPSIGGYQSTLDSDVATIEDRLFA 284 Mycoplasma croc...
WP_012498277 203 ISKMNEMPGARMSIVPMGLTAAEYLRDkEKEDVLLFIDNIFRFLQAGNEVSSSLGKRPSIGGYQATMDSDIAAIEDRMFK 282 Mycoplasma arth...
CDD56548     203 FGQMGDNSASRSHAIYSGLTLAEYLRDeKKQDVLLFVDNIYRYVQAYSEISAMMNRMPIENGYPATIEMNVSEVEERINS 282 Clostridium sp....
CCY89042     204 FGQMGDNPVSRSKSVYTGLTVAEYLRDeKKQDVLAFIDNIYRFIQAKAEINTELKRIPVENGYPTTMISDISSVEERINS 283 Mycoplasma sp. ...
CDE95046     203 FGAMGDNPVSRSKSVYSGLTFAEYLRDeKKQDVLIFIDNIYRFIQAKSEISTELKELLIENGYPADMASEISKIEERISS 282 Clostridium sp....
5B0O_A       315 gIhGgGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRRLAEAGHYPAIDIEASIS 373 Salmonella enterica subsp. enterica ...
Q4A5U8       283 -N-EnGSITSFQTVFLPMDDLSDPSAVAVFNHLNSSLVLSREISAKNIFPAFDPLVSSS 339 Mycoplasma synoviae 53
Q4A9L0       254 -N-EnGSITSFQTVFLPMDDLSDPAAISLFTHLDSSFVLSRDKMSRNIFPAFDPLVSTS 310 Mycoplasma hyopneumoniae J
Q7NAJ3       287 -T-EdGSITSFQTLFLPMDDLADPSAVSIFSNLDGSLVLSREQTSKNIFPAFDPLASSS 343 Mycoplasma gallisepticum
CRH24475     211 -N-QnGAITSFQTIFLPMDDLSDPSAVAVFNHLDGKLVLSREQSSKNIFPAFDPLASSS 267 Chlamydia trachomatis
WP_013054227 285 -N-EnGSITSFQTVFLPMDDISDPSAVAIFNHLDATLVLSRELTSKNIFPAIDPISSSS 341 Mycoplasma crocodyli
WP_012498277 283 -N-DnGSITSFQTVFLPMDDLSDPSAVAIFKHLNGNLVLSRDQAAKNIFPSFDPLASSS 339 Mycoplasma arthritidis
CDD56548     283 -T-PhGSITSFQAIYIPADDVTDEAVQTIMQHLDGQVVLSRKVAEKGLYPAIDVFATTS 339 Clostridium sp. CAG:43
CCY89042     284 -C-DtGSITSFQAIYIPADDITDEAVQTILSHMDGQIVLNRKVAEQGLYPAVDVSRSSS 340 Mycoplasma sp. CAG:956
CDE95046     283 -T-DnGSITSFQAIYIPADDYNDEAVQTITSYMDGQIVLDRKVAELGLYPAIDVFKSTS 339 Clostridium sp. CAG:914
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap