Conserved Protein Domain Family
SH3_ARHGEF37_C2

?
cd11941: SH3_ARHGEF37_C2 
Second C-terminal Src homology 3 domain of Rho guanine nucleotide exchange factor 37
ARHGEF37 contains a RhoGEF [or Dbl homology (DH)] domain followed by a Bin/Amphiphysin/Rvs (BAR) domain, and two C-terminal SH3 domains. Its specific function is unknown. Its domain architecture is similar to the C-terminal half of DNMBP or Tuba, a cdc42-specific GEF that provides a functional link between dynamin, Rho GTPase signaling, and actin dynamics, and plays an important role in regulating cell junction configuration. GEFs activate small GTPases by exchanging bound GDP for free GTP. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies.
Statistics
?
PSSM-Id: 212874
View PSSM: cd11941
Aligned: 5 rows
Threshold Bit Score: 111.927
Threshold Setting Gi: 348542473
Created: 21-Nov-2011
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
peptide ligand
Feature 1:peptide ligand binding site [polypeptide binding site]
Evidence:
  • Comment:based on the binding of peptide ligands to the SH3 domains of other superfamily members
  • Comment:SH3 domains typically bind proline-rich ligands, preferentially to PxxP motifs.
  • Citation:PMID 7664083
  • Citation:PMID 7735837
  • Comment:flanking hinge and loops (RT and n-Src) confer sequence specificity for ligand residues outside the core binding motif

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
Feature 1             # #  #   #                     ##             # ##   
gi 189041163 607 QVVAVYPFVARSTHELSLQAGQPVTILEAQDKKGNPEWSLVEAN-GQRGYVPSNFLAR 663
gi 189041197 606 QVIAAYPFVARSSHEVSLQAGQPVTILEAQDKKGNPEWSLVEVN-GQRGYVPSGFLAR 662
gi 118097303 587 QVVAGFSFTARSPQELSLQAGQPVVVLEPHDKKGSTEWSLVEVN-GQRGYVPSSYLLT 643
gi 49257700  598 QIIAGYGFTARSDYEASLIAGEPVTVLEPHDKKGSTEWSLVEVR-GQRGYVPSSYLLR 654
gi 348542473 848 PVVGAYDFTARSKHEVSFRAGEPVRVLEPHDKRGSPEWSLVEVRgGQRGYVPSTYLAI 905

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap