Conserved Protein Domain Family
Cas6_I-E

?
cd09727: Cas6_I-E 
Click on image for an interactive view with Cn3D
CRISPR/Cas system-associated RAMP superfamily protein Cas6e
CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family
Statistics
?
PSSM-Id: 187858
View PSSM: cd09727
Aligned: 50 rows
Threshold Bit Score: 120.876
Threshold Setting Gi: 123527476
Created: 23-Nov-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1WJ9_A         1 MWLTKLVLNPAsraar---------rdlaNPYEMHRTLSKAVSrale------egrERLLWRLEparg--leppVVLVQT 63
gi 81401059    5 IHLVKLPVHIAlsvpaknk--prkgweltDPSFRHRAVMALFPdtdsp---lprksVDILFRFEqlag---qppFFLIQS 76
gi 123629432   2 TWLTKIVPDLRyrqtr---------adfrTAGNLHRKLIRLSSdlgeerianprqqSGLLFRIEetr----nelYLLVQS 68
gi 122390877   3 IWLTRIVPDLRsrdarr------dltgtaTAVGLHRRLMALFPqdagp---dpraqFGVLFRIEdtt----tgpHVLLQS 69
gi 81715908    3 VWLTRIVPDPRsrdarr------dlggndSAMGLHRRLMSLYPcdagp---dprarFGVLFRIEdtp----agaHILLQS 69
gi 81790635    1 MIATMLTLSRKdvka----------lritDSYSLHRVIYSLFEdvrseaekrssvpSGFLFADKggda---kgrKILILS 67
gi 81682525    5 LYMIELRPDPAalirfaqdqglnthqdqdLGYATHAWLKALCGe-----------lAPKPFRLLqdgrn-lrppRLLGFS 72
gi 123527476   4 LYLISLPLDMVsfhrwag----qrgigtdEGRALHHLLGESFG-------------KGVLQPFRlmvapngatgTLYAYT 66
gi 147675727   4 LFASALHLDRRavka----------lkitDAYSLHRVVYSLFPdvrspeekgghtqSGIVYADQggdf---hgrKVLVVS 70
gi 159037599   3 AWLTRIALDLRhsaar---------rdlrDTTALHRRVMSLVPdglge---qprhhAGVLFRLDhtt----tgpMLLVQT 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1WJ9_A        64 Lt-EPDWSvldeg------------yaqvFPPKPFHpal---kpGQRLRFRLRANPAKRlaatgk--------------- 112
gi 81401059   77 Tv-APKQVdnl---------------dseVQHRTVSlrr--fspKSAVRFRISINGIRRqttehngrkritts------- 131
gi 123629432  69 H--SPLRVdrlgp------------gyhgVQMRNLDpflarldkGSRVRYRIVASPTKRlgrsenntqrlglk------- 127
gi 122390877  70 Th-EPDLTrlpd-------------gygtSLSRPLDplldalepGLTVRYRCVASPVRKpgattrevy------------ 123
gi 81715908   70 Ah-EPDLTrlpd-------------gygqAITRPLDplldalkpGLTIRYRCTASPVRKpgantraly------------ 123
gi 81790635   68 D--RPPLQpah----------------geLVSRPVPeef---lqHRFYKFEVTLNPTRKenksgk--------------- 111
gi 81682525   73 AhdGTRLTeharafaspl-aaqvcsladgIAFKPMPesw---pnGRKLGFEVMACPISRlgrneddvyrrhl-------- 140
gi 123527476  67 R--ADRTAlvqttrdfglpdalavcdparLAAKAMPedw---reGRRLAFDLRARPVRRllkpagvfpkgaevdafllea 141
gi 147675727  71 Dr-MPNASvdgv--------------hgeVVSKTISeaf---lhHQTYRFKVQVNPVRKdkqsgk--------------- 117
gi 159037599  67 Tl-PPDPNrlpd-------------gyaaVDTRDVSpllkaltnGMAMHYRIAANASKRawkgnsa-------------- 118
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1WJ9_A       113 --------------rvalktPAEKVAWLERRLEEGGf--RLLEGErgpwvqilqdtflevrrkkdgeeagklLQVQAVLF 176
gi 81401059  132 -------pvpfdsdekapshITRMTPWVQKKLNGAL---RNVEILnhqrevigt---------khrggkaasMTIQIDTV 192
gi 123629432 128 ------eppkkpreytwalrGAAAEEWWHSRAAANGl--ELLSTYaqtlddvrd---------pgtadrsrkIRHPAVRF 190
gi 122390877 124 -----------nlpavvplsGAAADEWWLRQADTAGl--KSLTHHaqpldpaqgtr------gphtpgkeqrVRHARTRF 184
gi 81715908  124 -----------nlpavvplnGAAADEWWTRQADAAGl--KPLALHphpldaaqgv--------ragngdkqrIRHNRIRF 182
gi 81790635  112 --------------rvpiktREEVAAWFGGKSQTSW---GFSVDParldvrmlpv-------mqfskqgdrtVTHGAARV 167
gi 81682525  141 -------rdcdaraqspdsrEMVYRRWLTRQFGSAAtldDFSLDGfrylrllr-----------kargtrsgFLAPQALF 202
gi 123527476 142 lrrfpegrpaegvagapitrEGVYFQWLAERLSGAArveEVRLARferrav---------------lrgsksIEGPDAVF 206
gi 147675727 118 --------------riavkgRQDIAQWFIERAAKSWg-fEVHPQHlqidsievq---------qfndkhgrkITLGKAHI 173
gi 159037599 119 -------------gkvvalsGQQAEQWWQRKAEATGl--DLRHLRaqpqpaa--------------rgraipVRHAITLF 169
                        250       260       270
                 ....*....|....*....|....*....|....*
1WJ9_A       177 EGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP 211
gi 81401059  193 DGFGIVEDPELLNELILHGVGRAKAYGCGLLSVSE 227
gi 123629432 191 DGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLAL 225
gi 122390877 185 DGSAIINDPDLLRQKITEGIGRGKAYGCGLLSIAP 219
gi 81715908  183 DGSATITDPDLLRQKITEGIGRGKAYGCGLLSIAP 217
gi 81790635  168 SGMLRVENRDLFIESFNKGIGRGRAFGFGLLQIEP 202
gi 81682525  203 RGTLSVRDGAGFGALLARGIGRHRAFGFGMLLLRP 237
gi 123527476 207 HGELVILDGAKFAGHLASGLGRHTAYGYGMMLLRP 241
gi 147675727 174 QGQLRVTNEPQFHHSFKHGIGKGRAFGCGLLQIVP 208
gi 159037599 170 EGQAVITDADQVRAAVLAGIGRGRSFGCGLLSLAP 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap