Conserved Protein Domain Family
Thaumatin-like

?
cd09215: Thaumatin-like 
Click on image for an interactive view with Cn3D
the sweet-tasting protein, thaumatin, and thaumatin-like proteins involved in host defense
This family is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii and thaumatin-like proteins (TLPs) involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs included in this family are such proteins as zeamatin, found in high concentrations in cereal seeds; osmotin, a salt-induced protein in osmotically stressed plants; and PpAZ44, a propylene-induced TLP in abscission of young fruit. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). Thaumatin and TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Most TLPs contain 16 conserved Cys residues. A deletion within the third domain (domain II) of the Triticum aestivum thaumatin-like xylanase inhibitor is observed, thus, only 10 conserved Cys residues are present within this smaller TLP and similar homologs.
Statistics
?
PSSM-Id: 185754
View PSSM: cd09215
Aligned: 6 rows
Threshold Bit Score: 191.124
Threshold Setting Gi: 108860317
Created: 25-Aug-2010
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Hierarchy
?
Display:
 
electronegati..
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:electronegative/electropositive cleft residues
Evidence:
  • Comment:Thaumatin-like proteins are crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II.
  • Comment:It has been proposed that the antifungal activity of plant PR5 proteins (pathogenesis-related protein family 5) relies on the strong electronegative character of the cleft with conserved cleft residues: Arg, Glu, Asp, and Asp.
  • Comment:Sweet-tasting protein thaumatin has an electropositively charged cleft (with conserved cleft residues Lys, Glu, Asp, and Lys, instead of Arg, Glu, Asp, and Asp) and lacks antifungal activity.

cd09215 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd09215 is a member of the superfamily cl02511.
cd08961:GH64-TLP-SFcd09214:GH64-likecd09215:Thaumatin-likecd09216:GH64-LPHase-likecd09217:TLP-Pcd09218:TLP-PAcd09219:TLP-Fcd09220:GH64-GluB-like1Z3Q A1PCV A1AUN A2I0W A1DU5 A1THV A297719553354969324194430717107853G7M A241920563215530029087177694077210886031721545117550257998289265251607045452100721942419211081524255225011822848218862AHN A250914053010871182228741611946906323439369224192313429731462821941171754003417543804187023844409499675779122657791224101778622397916891569388871167909741521950875270948605431241478440861232389316268264018420282152174452235319473001403703001393523001616933001646891Z3Q A1PCV A1AUN A2I0W A1DU5 A1THV A297719553354969324194430717107853G7M A241920563215530029087177694077210886031721545117550257998289265251607045452100721942419211081524255225011822848218862AHN A25091405301087118222874161194690632343936922419231342973146282194117175400341754380418702384440949967577912265779122410177862239791689156938887116790974152195087527094860543124147844086123238931626826401842028215217445223531947300140370300139352300161693300164689
cd09215 Sequence Cluster
cd09215 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd09215 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                           #                            
1Z3Q_A         3 FEIVNRCsYTVWAAAVp-----------gGGRQLNqgQSWTINVNAgttGGRIWGRTGCsfdg------------sgrGR 59
gi 108860317  24 FTVYNGCpFTIWPAMFtgvnqataspaytTGWAANayTAVSFSVPDnwqAGRIWARRDCdfsv-----------npgpNS 92
2AHN_A         3 ISFKNNCpYMVWPGTLtsdqk---pqlstTGFELAsqASFQLDTPVp-wNGRFWARTGCstda------------sgkFV 66
gi 28926525  137 LVITNSCpDTIWPGIGtqngi----gpevGGFELApgETKPLFVSPd-wQGRVWGRTNCsfnadgtgpsnlngvngngAA 211
gi 160704545  59 LLVTNRCpGDIWPGIStqsgk----gpkeNGFKLQpgETKNQTVSEd-wQGRVWGRTNCtfnsdgt-----gpasgsgKA 128
gi 210072194  46 FRITNHCpVDIYPAIQtqagt----gpafGGYHALpgNTTSFDVSAg-wQGRIWARTNCtfnengm-----stngmgaDA 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                   #              #    #                                
1Z3Q_A        60 CQTGDCgg-vlSCTAYgn---pPNTLAEFALnqf--nnlDFFDISLVDGFNVPMDFSPts--ggCRGIRCAAdingqcpg 131
gi 108860317  93 CLDGGCng-glVCDPTtgtgvpPASLAEFTLsga--gglDYFDISFVDGYNLPISITNnv---nCPAPICAVdlgpncpa 166
2AHN_A        67 CATADCasgqvMCNGNga--ipPATLAEFNIpag--ggqDFYDVSLVDGFNLPMSVTPqggtgdCKTASCPAnvnavcps 142
gi 28926525  212 CMTGDCfg-rlNCEFTgq---vPVTLAEFNLlgginsdqTFYDISLVDGYNLPLGIIYip--aaNTTWIPPNltncvcia 285
gi 160704545 129 CYSGDCng-ilNCQVGgd---vPVSLAEFTLdag--dghTYYDISLVDGYNVPIAIVLqp--leNITLDDIPpnltnpsc 200
gi 210072194 116 CLTGDCgg-llDCQGTg----kPATLAEFTMsgs--mnlSYYDISLVDGYNLPLGIISlh--ieSSDPDLKNipsnttnp 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1Z3Q_A       132 alkapggcnnpctvfk---------------------------------------------------------------- 147
gi 108860317 167 plagpfdstgfpvgcksacdanldg------------------------------------------------------- 191
2AHN_A       143 elqkkgsdgsvvaclsacvkf----------------------------------------------------------- 163
gi 28926525  286 sagfldppsrsglyytnktfpipwesdqtnpsvggwcpwdlqeyppskp------------gdgiypypddsiqrpvfdp 353
gi 160704545 201 qgtdgllaaqdynpypeypdflrtntsyplpfdkkvdqnqiskwcpwdlqqtp----pdkpgdgvypypddniqrpqfnp 276
gi 210072194 187 vcigspnflqatnqlengttvpsnstigsitystplemtlsthavsqwcpwplqiqpppkpgagvypypddgiarpdfdp 266
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                              
1Z3Q_A       148 --------------tdqyccnsgacsptdysqffkrnCPDAYSYpkdd--qttTFTCPg--GTNYRVVFC 199
gi 108860317 192 ----dqqnspnccsgqydtpatcpvsgveyytyfkdaCPDAYAYaydessesaLWTCAdslNADYTITFC 257
2AHN_A       164 --------gtpqycctppqntpetcpptnyseifhnaCPDAYSYaydd--krgTFTCNg--GPNYAITFC 221
gi 28926525  354 clsacaatgnpedcctgkyddpsvctpslysenaktvCPDAYSYafdd--qtsTFIIPn--GGGWEVVFC 419
gi 160704545 277 cfsacaknnkpeecctgeynspskchvseysknvkavCPDAYSFafdd--qtsTFIIPs--GAGFEVVFC 342
gi 210072194 267 clslcsrygksnycctgkhgtadkcspnmyskaakkvCPDAYSYaydd--ttsTFTVKq--GAGFEVVFC 332

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap