3O7P,1PW4,2Y5Y,4GBY,4GC0,4J05,4LEP,4M64,4OAA,4U4T,4ZOW,4ZP0,4ZW9,5A2N,5AYM,5EQG


Conserved Protein Domain Family
MFS

?
cd06174: MFS 
Click on image for an interactive view with Cn3D
Major Facilitator Superfamily
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.
Statistics
?
PSSM-Id: 349949
View PSSM: cd06174
Aligned: 86 rows
Threshold Bit Score: 45.8806
Threshold Setting Gi: 835020571
Created: 9-Jul-2008
Updated: 11-Jul-2018
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative
Conserved site includes 35 residues -Click on image for an interactive view with Cn3D
Feature 1:putative chemical substrate binding pocket [chemical binding site]
Evidence:
  • Comment:based on the structures of MFS transporters with bound substrates, substrate analogs, and/or inhibitors
  • Comment:since MFS proteins facilitate the transport of many different substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides, the residues involved in substrate binding may not be strictly conserved among superfamily members
  • Comment:the substrate binding site or translocation pore has access to both sides of the membrane in an alternating fashion through a conformational change of the MFS transporter
  • Structure:3O7P; Escherichia coli FucP binds B-nonylglucoside; contacts at 5A
    View structure with Cn3D
  • Structure:4OAA; Escherichia coli Lactose permease binds high-affinity lactose analog; contacts at 5A
    View structure with Cn3D
  • Structure:4ZP0; Escherichia coli MdfA binds deoxycholate; contacts at 5A
    View structure with Cn3D
  • Structure:4ZOW; Escherichia coli MdfA binds chloramphenicol; contacts at 5A
    View structure with Cn3D
  • Structure:4GBY; Escherichia coli Proton:xylose symporter XylE binds D-xylose; contacts at 5A
    View structure with Cn3D
  • Structure:4GC0; Escherichia coli Proton:xylose symporter XylE binds 6-bromo-6-deoxy-D-glucose; contacts at 5A
    View structure with Cn3D
  • Structure:4J05; Serendipita indica Phosphate transporter binds inorganic phosphate; contacts at 5A
    View structure with Cn3D
  • Structure:4LEP; Shewanella oneidensis proton dependent oligopeptide transporter in complex with the peptidomimetic alafosfalin; contacts at 5A
    View structure with Cn3D
  • Structure:2Y5Y; Escherichia coli LacY binds affinity inactivator; contacts at 5A
    View structure with Cn3D
  • Structure:4ZW9; Human Glut3 binds D-glucose; contacts at 5A
    View structure with Cn3D
  • Structure:5EQG; Human GLUT1 binds inhibitor; contacts at 5A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1               ##  ##  #                                  #                             
3O7P_A        31 LCSLFFLWAVANNLNDILLPqfqqaf---tltnfqAGLIQSAFYFGYFIIPIPAGILMKkls-ykaGIITGLFLYALGAA 106
4U4T_A        41 SVPCLLLAFCVWMLFSAVAVnlpkvgf--nfttdqLFMLTALPSVSGALLRVPYSFMVPifg-grrWTAFSTGILIIPCV 117
gi 140479     41 VCLQYWINYVDRVGFTNAYIsgmkedl--kmvgndLTVSNTVFMIGYIVGMVPNNLMLLcvp-priWLSFCTFAWGLLTL 117
gi 13432278   17 LGTVFSLRMLGMFMVLPVLTtygmalq--gasealIGIAIGIYGLTQAVFQIPFGLLSDrig-rkpLIVGGLAVFAAGSV 93
gi 15607982   28 LLGGNLLVRSAGFGYPFLAYhvagrg----hgagaVGAVVAAYGLGWAVGQLLCGWLVDrvg-arvTLVSTMLVAAAVLV 102
gi 67462066   11 VSFGFLLLFTAYGGLQSLQSslys-------eeglGVTALSTLYGGMLLSSMFLPPLLIerlgckgTIILSMCGYVAFSV 83
gi 74723223   16 VFVSFLTQFLCYGSPLAVGVlyiewldafgegkgkTAWVGSLASGVGLLASPVCSLCVSsfg-arpVTIFSGFMVAGGLM 94
gi 75427848   14 IWAGQAVSLITSAILQMAIIfyltek---tgsamvLSMASLLGFLPYAVFGPAIGVLVDrhd-rkkIMIGADLIIAAAGS 89
gi 75468940   21 AMGMPMMIFYAIGILGPHLVadlgi------srqqLGWLTASTFGLAALLSPWAGALVQrmg-traGLICMFLLVGLSFS 93
gi 167008994  15 LLIDNMLVVLGFFVVFPLISirfvdqm--gwaavmVGIALGLRQFIQQGLGIFGGAIADrfg-akpMIVTGMLMRAAGFA 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                  ## ###  #                                 #  ##  #    
3O7P_A       107 Lfwpaaei--mnytlfLVGLFIIAAGLGCLETAANPFvtvlgpess--------------ghfrlnlaQTFASFGAIIAV 170
4U4T_A       118 WlgfavqdtstpysvfIIISLLCGFAGANFASSMANIsfffpkqk---------------qggalglnGGLGNMGVSVMQ 182
gi 140479    118 Gmykvt-----sfkhiCAIRFFQALFESCTFSGTHFVlgswykede--------------lpirsaifTGSGLVGSMFSG 178
gi 13432278   94 Iaalsd-----siwgiILGRALQGSGAIAAAVMALLSdltreqnrtk------------amafigvsfGITFAIAMVLGP 156
gi 15607982  103 Lmaglh-----tvpglLVGAMIAGLVCDAPRPVLGAViaelvadpqrra--------qldgwrygwvlNIGAAITGGVGG 169
gi 67462066   84 Gnffas------wytlIPTSILLGLGAAPLWSAQCTYltitgnthaekagkrgkdmvnqyfgifflifQSSGVWGNLISS 157
gi 74723223   95 Lssfapn----iyflfFSYGIVVGLGCGLLYTATVTItcqyfddr---------------rglalgliSTGSSVGLFIYA 155
gi 75427848   90 VltivafymelpvwmvMIVLFIRSIGTAFHTPALNAVtpllvpeeq--------------ltkcagysQSLQSISYIVSP 155
gi 75468940   94 Lmavlp-----gfgglVTALLLCGTAQSLANPATNQAiahsvpvar--------------kagvvglkQSGVQASALLAG 154
gi 167008994  92 Tmgiah-----epwllWFSCLLSGLGGTLFDPPRSALvvklirpqq--------------rgrffsllMMQDSAGAVIGA 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3O7P_A       171 VFGQSLilsnvphqsqdvldkm--------speqlsaykhslvlsvQTPYMIIVAIVLLVALLImltkfpalqsdnhsda 242
4U4T_A       183 LVAPLVvslsifavfgsq----------------gvkqpdgtelylANASWIWVPFLAIFTIAAwfgmndlatska---- 242
gi 140479    179 FMQTSIfthlngr---------------------------nglagwRWLFIIDFCITLPIAIYGfiffpglpdqtsavsk 231
gi 13432278  157 IITHKLg--------------------------------------lHALFWMIAILATTGIALTiwvvpnssthvlnre- 197
gi 15607982  170 VVAGWLd--------------------------------------tPVLYWINGIGCAIFAGLAgrcipadvcrrtesgl 211
gi 67462066  158 LVFGQTpsqetlpeeqltscgasdclmattttnstqrpsqqlvytlLGIYTGSGVLAVLMIAAFlqpirdvqresegekk 237
gi 74723223  156 ALQRMLvef----------------------------------yglDGCLLIVGALALNILACGslmrplqssdcplpkk 201
gi 75427848  156 AVAALLysv----------------------------------welNAIIAIDVLGAVIASITVaivripklgdrvqsld 201
gi 75468940  155 VALPPLvlm----------------------------------wgwRGALAAWVPVALVMAALVtywvpaksvsa----- 195
gi 167008994 153 LLGSWLlqy-----------------------------------dfRLVCATGAVLFVLCAAFNawllpawklstvr--- 194
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3O7P_A           --------------------------------------------------------------------------------
4U4T_A           --------------------------------------------------------------------------------
gi 140479    232 fsmtryifneqe--------------------------------------------------------------lhyarr 249
gi 13432278      --------------------------------------------------------------------------------
gi 15607982  212 r------------------------------------------------------------------------------- 212
gi 67462066  238 s------------------------------------------------------------------------------- 238
gi 74723223  202 iapedlpdkysiynekgknleeninildksysseekcritlangdwkqdsllhknptvthtkepetykkkvaeqtyfckq 281
gi 75427848  202 p------------------------------------------------------------------------------- 202
gi 75468940      --------------------------------------------------------------------------------
gi 167008994     --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                       #  ##  ###  #                            #   #   
3O7P_A       243 -------kqgsfsaslsrlariRHWRWAVLAQFCYVGAQTACWSYLiryaveeipgmtagfaanYLTGTMVCFFIGRFTG 315
4U4T_A       243 -----------sikeqlpvlkrGHLWIMSLLYLATFGSFIGFSAGFamlsktqf---pdvqilqYAFFGPFIGALARSAG 308
gi 140479    250 rlpardestrldwstiprvlkrWHWWMFSLVWVLGGENLGFASNSTfalwlqnqk-ytlaqrnnYPSGIFAVGIVSTLCS 328
gi 13432278  198 --------sgmvkgsfskvlaePRLLKLNFGIMCLHILLMSTFVALpgqladag--fpaaehwkVYLATMLIAFGSVVPF 267
gi 15607982  213 ------actamskvgyrqalsdKRLVLLAVSGLATLTTLMGFFAAVpmlmsasg--lgvgaygwVQLINALAVVAVTPLL 284
gi 67462066  239 ------vpfwstllstfklyrdKRLCLLILLPLYSGLQQGFLSSEYtrsyvtct--lgiqfvgyVMICFSATDALCSVLY 310
gi 74723223  282 lakrkwqlyknycgetvalfknKVFSALFIAILLFDIGGFPPSLLMedvarssnv-keeefimpLISIIGIMTAVGKLLL 360
gi 75427848  203 ------nfiremqegmavlrqnKGLFALLLVGTLYMFVYMPINALFplismdy-----fngtpvHISITEISFASGMLIG 271
gi 75468940  196 -----------pslplrvrgpnVWLSILMAIQLCAGLALSSFMTFLgvyaaqig--vsvstigaMVSCFGAMGILSRVLL 262
gi 167008994 195 ---------tpvregmtrvmrdKRFVTYVLTLAGYYMLAVQVMLMLpimvndva--gapsavkwMYAIEACLSLTLLYPI 263
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                ##   #   #              
3O7P_A       316 TWLisr---fapHKVLAAYALIAMALCLIsafagghv---------glialtlCSAFMSIQYPTIFSLgiknl------- 376
4U4T_A       309 GALsdr----lgGTRVTLVNFILMAIFSGllfltlptdgqggsfmaffavflaLFLTAGLGSGSTFQMisvifrkltmdr 384
gi 140479    329 AVYmski--praRHWHVSVFISLVMVIVAvliradpln------pkvvfsaqyLGGVAYAGQAVFFSWaniicha----- 395
gi 13432278  268 IIYaev---krkMKQVFVFCVGLIVVAEIvlwnaq-------------tqfwqLVVGVQLFFVAFNLMeallpslis--- 328
gi 15607982  285 TPWlskqlalgpRPDILAGAGVWVTLCMAaaglartt--------vgfsvaaaACSPGEIAWFVVAAGivhria------ 350
gi 67462066  311 GKVsqy----tgRAVLYVLGAVTHVSCMIalllwrp-----------radhlaVFFVFSGLWGVADAVwqtqnnaly--- 372
gi 74723223  361 GILadfk--winTLYLYVATLIIMGLALCaipfaksyv-------tlallsgiLGFLTGNWSIFPYVTtktvg------- 424
gi 75427848  272 GLLlglfgnyqkRILLITASIFMMGISLTisgllpqsgf-----fifvvccaiMGLSVPFYSGVQTALfqekik------ 340
gi 75468940  263 TPIadk---lkdETILLGVLFILAGLALAvmreantqqh-----wplwlgvtgMGLTVAASNAIAMSMllrdgr------ 328
gi 167008994 264 ARWsek---hfrLEHRLMAGLLIMSLSMMpvgmvsglq-------qlfnliclFYIGSIIAEPARETLsaslad------ 327
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
Feature 1                              #  ##  ##  #                                           
3O7P_A       377 ---------------gqdtkYGSSFIVMTIIGGGIVTPVmgfvs--------daagnIPTAELIPALCFAVIFIFAR 430
4U4T_A       385 vkaeggsderamreaatdtaAALGFISAIGAIGGFFIPKafgssl-------altgsPVGAMKVFLIFYIACVVITW 454
gi 140479    396 --------------dlqeraIVLASMNMFSGAVNAWWSIlffas--------dmvpkFERGCYALLATAISSGIVSV 450
gi 13432278  329 -----------kespagykgTAMGVYSTSQFLGVAIGGSlggwi--------ngmfdGQGVFLAGAMLAAVWLTVAS 386
gi 15607982  351 --------------ppahggRYHGIWSMAVAASSVAAPIlaafnlanggrlvlaattVTVGFFGAALCLPLARVLAA 413
gi 67462066  373 -----------gvlfekskeAAFANYRLWEALGFVIAFGysm------------flcVHVKLYILLGVLSLTMVAYG 426
gi 74723223  425 ---------------ieklaHAYGILMFFAGLGNSLGPPivgwfy-------dwtqtYDIAFYFSGFCVLLGGFILL 479
gi 75427848  341 ---------------peylgRVFSLTGSIMSLAMPIGLIlsalf--------adrigVNHWFLLSGTLIICIAIVCP 394
gi 75468940  329 ---------------fggaaTSAGMLSVGFFGGFAVGPPafgwfl-------ahsegFAAAWLSLIGILVAGGLLCL 383
gi 167008994 328 ---------------arargSYMGFSRLGLAIGGAIGYIgggwlfd----lgksahqPELPWMMLGIIGIFTFLALG 385

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap