Conserved Protein Domain Family
MutL_Trans_MutL

?
cd03482: MutL_Trans_MutL 
Click on image for an interactive view with Cn3D
MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL. EcMutL belongs to the DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from the ATP-binding site to the DNA breakage/reunion regions of the enzymes. It has been suggested that during initiation of DNA mismatch repair in E. coli, the mismatch recognition protein MutS recruits MutL in the presence of ATP. The MutS(ATP)-MutL ternary complex formed, then recruits the latent endonuclease MutH. Prokaryotic MutS and MutL are homodimers.
Statistics
?
PSSM-Id: 239564
View PSSM: cd03482
Aligned: 25 rows
Threshold Bit Score: 152.737
Threshold Setting Gi: 27904385
Created: 17-Feb-2006
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Hierarchy
?
Display:
 
ATP binding
Conserved site include 1 residue -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Structure:1B63_A, Escherichia coli MutL bound with Adpnp ((non-hydrolyzable ATP analog), contacts at 3.5A
    View structure with Cn3D
  • Comment:conserved Lys residue from the transducer domain interacts with the gamma-phosphate of bound nucleotide.

cd03482 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd03482 is a member of the superfamily cl02783.
cd00329:TopoII_MutL_Transcd00782:MutL_Transcd00822:TopoII_Trans_DNA_gyrasecd00823:TopoIIB_Transcd03481:TopoIIA_Trans_ScTopoIIAcd03482:MutL_Trans_MutLcd03483:MutL_Trans_MLH1cd03484:MutL_Trans_hPMS_2_likecd03485:MutL_Trans_hPMS_1_likecd03486:MutL_Trans_MLH311386926279043851B63 A7687414769158174768821815617845285710758526300145660412078701445783637144953144129541657204551602045508833566697475753636791082434496797204551523018073974317535718483986821370211386926279043851B63 A76874147691581747688218156178452857107585263001456604120787014457836371449531441295416572045516020455088335666974757536367910824344967972045515230180739743175357184839868213702
cd03482 Sequence Cluster
cd03482 Sequence Cluster
Sub-family Hierarchy
Click to see CD Hierarchy help
 cd03482 Branch
 Whole Hierarchy
 [Download CDTree]
CD Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1B63_A      210 KERRLGAICGTAFLEQALAIEwqhgdLTLRGWVADPnhttpaLAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADqqPA 289
gi 78701445 210 AERRLGELLGEGFLGECIHLEcaaagLKLSGWLALPtfs-rsQGDLQYFYVNGRMIRDRMAGHALRRAYADVLYRDrfPA 288
gi 76882181 209 QLKRITELCGRNFAEHSMYFKreiegLCLWGWLGHPefa-rsQTDLQYCYVNHRMVRDKLLSHAARQAYGNRLSQGrhPA 287
gi 56178452 208 QLQRLAKICGGGFAEQASAIDavdgdFHLSGWLVPPehc-rhQGDIQHFFVNGRMMRDKLLSHAVRQAYEKYLPNErvPT 286
gi 85710758 210 WRRRLAKVCGSGFAQDALYFQqhahdIHIEGWLAAPeqc-rhQGDVQYSFVNGRMMKDKLINHAIRQAYDSFLTAErvPT 288
gi 56604120 212 KYNRVLDLYSREFIENAIYVDkqvgdAHLWGWVASPrfn-raRADMQSFYINGRIIKDKIVSHAIKNAYKDVMYGNryPA 290
gi 78363714 220 LKQRLKQLMGTPFVDQSLELNfeaqdIQLSGWVGQAtfn-rsQTDMQYLFVNGRIVRDRLLSYAVKQAYADVLYHGrhPA 298
gi 76874147 208 AIARVAQVAGKAFAEQGLHIQsgeggLQLHGWVLPVg----sANTVQYTYVNNRMMRDKLILHAIRQAFEEVSGAQelPG 283
gi 52630014 208 KAIRMGRILGNTFMREAIFLDvehsgMRLYGWISNHrlq-rsQNDRQWIYVNQRMVKDKLLQHAVKQAYDGLLHAGrfPI 286
gi 69158174 208 MQQRLSQICGRAFAEQAITLAcehdgLSLEGYIQSPhd--nsVTDTNYFYVNGRLVRDKLVNHAVRQAFAEHQWHQq-PS 284
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....
Feature 1                          #                        
1B63_A      290 FVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQ 333
gi 78701445 289 YLLYLDLDPDRVDVNVHPTKHEVRFRDSRLVYDFLFRQVREALA 332
gi 76882181 288 YLLYLELPTHQVDVNAHPAKHEVRFRESRQVHGFIVRTLAEILE 331
gi 56178452 287 FVLYFELPAEEVDVNVHPAKHEVRFHRQRQVHDFILTRIEQALN 330
gi 85710758 289 FAIYLTVPADQVDVNVHPAKHEVRFHQQRQVHDFVLNTVKQLLL 332
gi 56604120 291 FLLYLDIDYCEVDVNVHPAKSEVRFRNQKFIYDFLFGNINKAIT 334
gi 78363714 299 YLLFLNIPHDLVDVNVHPAKYEVRFANGRWVYDFLRRSVREAVT 342
gi 76874147 284 FVIYIDIDPRQVDVNVHPAKHEVRFHQGRLVHDFILQAIKQVVV 327
gi 52630014 287 CLLYFTLPASEVDVNVHPTKHEVRFQQPRLVHDFFTSQLTKALQ 330
gi 69158174 285 YVLKLTLDPHQVDVNVHPAKHEVRFHQSRYVHDFILQALQSALA 328

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap