1NM3


Conserved Protein Domain Family
GRX_hybridPRX5

?
cd03029: GRX_hybridPRX5 
Click on image for an interactive view with Cn3D
Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins. PRX-GRX hybrid proteins from Haemophilus influenza and Neisseria meningitis exhibit GSH-dependent peroxidase activity. The flow of reducing equivalents in the catalytic cycle of the hybrid protein goes from NADPH -> GSH reductase -> GSH -> GRX domain of hybrid -> PRX domain of hybrid -> peroxide substrate.
Statistics
?
PSSM-Id: 239327
View PSSM: cd03029
Aligned: 5 rows
Threshold Bit Score: 137.262
Threshold Setting Gi: 34103346
Created: 14-Mar-2005
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
GSH bindingcatalytic
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:GSH binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #  ###                                     ##                     
1NM3_B      170 ESISIFTKPGCPFCAKAKQLLHDKGLSFEEIILGHDA-TIVSVRAVSGRTTVPQVFIGGKHIGGSDDLEKYFA 241 Haemophilus influenzae
CAB84403    172 ESVAIFTKPGCQFCAKAKQALQDKGLSYEEIVLGKDA-TVTSVRAITGKMTAPQVFIGGKYIGGSEDLEAYLA 243 Neisseria meningitidis ...
BAB77907    171 KLVSLFTKVGCPFCARAKAALQENGIEYEEITLGKGI-TTRSLRAVTGATTVPQVFIDGVLIGGSEALTDYLS 242 Nostoc sp. PCC 7120
AAQ59708    171 DQVVVFTKVGCPHCARAKAVLAENGYDFVEVPLDNKI-RGKVLGAVSGAMTAPQVFINGELIGSADEVEKRFA 242 Chromobacterium violace...
ZP_00474415 172 SFATLFTKPGCPYCTRAKEQLQRHGIGYEEIGVGQRDvTSRSLRAMTGRASVPQVWIDGEYIGGADDVTRFFA 244 Chromohalobacter salexi...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap