1LNZ,1UDX


Conserved Protein Domain Family
Obg

?
cd01898: Obg 
Click on image for an interactive view with Cn3D
Obg GTPase
The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation. Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans. The E. coli homolog, ObgE is believed to function in ribosomal biogenesis. Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Statistics
?
PSSM-Id: 206685
View PSSM: cd01898
Aligned: 143 rows
Threshold Bit Score: 176.461
Threshold Setting Gi: 68129953
Created: 6-Jan-2012
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 11 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Structure:1LNZ: Bacillus subtilis Obg binds guanosine-5',3'-tetraphosphate, a GTP analog and 2Mg2+, defined using 3.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                ######                                                                 
1LNZ_B      159 ADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGXVETDDg--------------------------------- 205 Bacillus subtilis
10720359    157 ADIGLVGFPNAGKSTLISTISNAKPKIANYEFTTLVPNLGVVSVDEk--------------------------------- 203 Helicobacter pyl...
NP_663087   160 ADVGLVGFPNAGKSTLISVLSAARPKIADYPFTTLVPNLGIVRYEDy--------------------------------- 206 Chlorobium tepid...
AAP76605    159 ADVGLVGFPNVGKSTLISTLSNAKPEVANYEFTTLIPHLGVVDADEf--------------------------------- 205 Helicobacter hep...
CAE09642    159 ADVGLVGFPNVGKSTLISTLSNARPEVANYEFTTLIPALGVVDVDEf--------------------------------- 205 Wolinella succin...
NP_905052   164 ADVGLVGFPNAGKSTLLSVLTAAKPKIANYPFTTLEPNLGIVAYRDk--------------------------------- 210 Porphyromonas gi...
ZP_00372143 159 ADVGLVGFPNAGKSTLISVVSNAKPEIANYEFTTLTPKLGLVEVDEy--------------------------------- 205 Campylobacter up...
CAH06770    165 ADVGLVGFPNAGKSTLLSAISAAKPKIADYPFTTLEPNLGIVSYRDg--------------------------------- 211 Bacteroides frag...
EAN33543     63 SDIALIGKPNSGKSSVIRRLTNARPRVANFPFSTRFPIHGILNQTQhdtnqvdkvgsaesveqeteetedef--dscgye 140 Theileria parva
XP_741422   144 TDLGIIGYPNVGKSTLLNKITNANVKIANYSYTSLFPNFGIYKCKNeakdmeshepdeaikveeykheiesnvseenekn 223 Plasmodium chabaudi
Feature 1                                                                                       
1LNZ_B      206 ------------------rSFVXADLPGLIEGAHQg-vGLGHQFLRHIERTRVIVHVIDXSglegrdpYDDYLTINQELS 266 Bacillus subtilis
10720359    204 ------------------sEFLMADIPGIIEGASEg-kGLGISFLKHIERTKVLAFVLDASrld-lgiKEQYKRLRLELE 263 Helicobacter pyl...
NP_663087   207 ------------------kSFVMADIPGIIEGAAEg-rGLGIQFLRHIERTKTLLIMVPSNte---diAAEYATLLKELE 264 Chlorobium tepid...
AAP76605    206 ------------------sSFVMADIPGIIEGASGg-kGLGIAFLKHIERTGFLLFVLDIMreq--slKEQWEILSLELE 264 Helicobacter hep...
CAE09642    206 ------------------sSFVMADIPGIIGGASEg-kGLGLEFLRHIERTKTLLFVIDLSnyr--epLEQFEILQKELS 264 Wolinella succin...
NP_905052   211 ------------------rSFVMADIPGIIEGASSg-kGLGLRFLRHIERNALLLFMIPADtd---niAKEYEILSRELV 268 Porphyromonas gi...
ZP_00372143 206 ------------------hSFVMADIPGIIEGASGg-kGLGLLFLKHIERTNFLLFVLDTMrqm--slKEQFIILKKELK 264 Campylobacter up...
CAH06770    212 ------------------qSFVMADIPGIIEGASEg-kGLGLRFLRHIERNSLLLFMIPADsd---diRKDYEVLLNELK 269 Bacteroides frag...
EAN33543    141 sdeeiddteeqidvtdpgdRISLVDVPGLIDGSSEg-kGLGHDFLRQIEHSKTLSYVIDSSnq---dpLGDYMSVRRELE 216 Theileria parva
XP_741422   224 eleiseknteaceervktrNYTVIDFPGIIEGLDKklsNVSYKYLEHLKYSKVLIYMFDINdk---ciVETYKNIKNVLV 300 Plasmodium chabaudi
Feature 1                      ## #                                                          ## 
1LNZ_B      267 EYnlrLTERPQIIVANKXDxp--eaAENLEAFKEKLtd--------------------------------dyPVFPISAV 312 Bacillus subtilis
10720359    264 KFsptLANKPFGVLLNKCDvveninEMTKDFCAFLNleaqklnafdlepylgflhpnltsdfennpneqsalFVLPLSAV 343 Helicobacter pyl...
NP_663087   265 KFdpsLLSKPRLVVITKMDia--peDFTMPELEKGV------------------------------------KVLAISSV 306 Chlorobium tepid...
AAP76605    265 KFspiLSQRAFGIVLSKSDmq--hlGEEFADKFDKQtqeleqfl--------------------aqkgnpqsFILPISSI 322 Helicobacter hep...
CAE09642    265 QFspeLSLRPFGIALSKVDal--skEEANEKIELFL------------------------------------KGIGLSSC 306 Wolinella succin...
NP_905052   269 AYneeLAQKRKVLAITKCDli--deELCEMLREELPtg---------------------------------lPVVFISAV 313 Porphyromonas gi...
ZP_00372143 265 SFskeLSKRSFGVMISKIDse--nlGLAKELKENIKdlenfl------------------------qdekpmFILKVSSL 318 Campylobacter up...
CAH06770    270 TFnpeMLDKQRVLAITKSDml--dqELMDEIEPTLPeg---------------------------------iPHVFISSV 314 Bacteroides frag...
EAN33543    217 LYnpeILEKDEIILLNKIDli--dnQTIFKLINTFLkht------------------------------nhnHIYFLSAK 264 Theileria parva
XP_741422   301 QYdqiFEKKKEVVILNKIDiy--qdKENINTVINYLkenl-----------------------------kndKIFCISAL 349 Plasmodium chabaudi
Feature 1                           
1LNZ_B      313 Tr----eGLRELLFEVANQL 328 Bacillus subtilis
10720359    344 Sa----lNTHALKFVLLKAL 359 Helicobacter pylori J99
NP_663087   307 Ag----qGLKALKDELWRQV 322 Chlorobium tepidum TLS
AAP76605    323 Qk----sGLKELVFEILNSL 338 Helicobacter hepaticus ATCC 51449
CAE09642    307 Qs-----NQYALSEALQNYI 321 Wolinella succinogenes
NP_905052   314 Aq----qGLEELKDTLWKEL 329 Porphyromonas gingivalis W83
ZP_00372143 319 Dk----tGLKELKFKLLEQV 334 Campylobacter upsaliensis RM3195
CAH06770    315 Sg----lGISVLKDILWTEL 330 Bacteroides fragilis NCTC 9343
EAN33543    265 Tg----eNMDFINTLFQKLY 280 Theileria parva
XP_741422   350 TgtnvieTIDEIILNINKEN 369 Plasmodium chabaudi

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap