Conserved Protein Domain Family
Triacylglycerol_lipase_like

?
cd01847: Triacylglycerol_lipase_like 
Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
Statistics
?
PSSM-Id: 238883
Aligned: 23 rows
Threshold Bit Score: 157.209
Created: 7-Oct-2004
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:by similarity to other members of this super-family
  • Comment:the active site resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases
  • Citation:PMID 7773790

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                #                                                                      
P40601       25 YNNLYVFGDSLSDGGNngrytv-----------------dgingTESKLYNDFIAQQLgielv----------------- 70  Photorhabdus lum...
YP_521482    34 YSAVVSFGDSLSDAGTynvgp------------------iknagGGMFTVNGIAGAIGadtvpsdnwaqlvsasavg--- 92  Rhodoferax ferri...
YP_523951    32 FAAQVSFGDSLSDVGTynvgf------------------vaaagGGHFSINGASANGKaangnnivnwtevvamnlglpa 93  Rhodoferax ferri...
ZP_00243916  23 YSSVVTFGDSLSDVGTyrtag------------------maalgGGKFTVNDGDIWVElvakdrgltppcaaeigl---- 80  Rubrivivax gelat...
NP_949194    55 FTGIYGFGDSYADTGAapggafrlagvpagcqslplpdncrftgGTNFVETLQSIYGLr--------------------- 113 Rhodopseudomonas...
ZP_01397947  33 PQRLIAFGDAMSDVGQn---------------------------GTRYTVNDGSINNWtlqiaakyd------------- 72  Verminephrobacte...
CAD14110     37 VQRMVVFGDSLSDIGTytpva-------------------qavgGGKFTTNPGPIWAEtvaaqlgvtltpav-------- 89  Ralstonia solana...
ZP_00857314  91 FTRLTVFGDSYADWGNemrag------------------ssvpaSGRFSAGLAMADVVqyhyg----------------- 135 Bradyrhizobium s...
ZP_01400899  39 VRGITVFGDSSSDVGTyadat------------------gdprnPGKFTVNPGKLWVEniaehyglaltpyralsl---- 96  Verminephrobacte...
ZP_01405287  37 VTSVKVMGDSLADSGTf---------------------------GLKFTVQGTAATGAgstqiwpervaanysqt----- 84  Acidovorax avena...
Feature 1                                        #                                              
P40601       71 ---------------------nskkGGTNYAAGGATAvadln-------------------nkhntQDQVMGYLAShsnr 110 Photorhabdus lum...
YP_521482    93 ------ktscsarvggfgvaetavaGCTNYAQGGSRVtdpngignasggav-aagtttagaltepvVTQIANYVKDsggf 165 Rhodoferax ferri...
YP_523951    94 pcaavtglidtagaealsvpvvshpGCNGYAQGGALVtnpygvhnthygtygaasglggaeltypvVTQINNYLADhggs 173 Rhodoferax ferri...
ZP_00243916  81 --------essgavaslaqassfqdACFGYAQGGARVtnpigpnnkallll-gspdgqygqltvpvATQVARHLAKvggr 151 Rubrivivax gelat...
NP_949194   114 -------------------------GLTNYAIGGALTdntntlnsei---------pglvpplpgfVYELARLAHDgvrf 159 Rhodopseudomonas...
ZP_01397947  73 -----------------kpltpvsaGGTSYATGNARIvakpdaag--------------nastrtlSEQIDSFLAKdrf- 120 Verminephrobacte...
CAD14110     90 ------------mgyatsvqncpkaGCFDYAQGGSRVtdpngighng----------gagaltypvQQQLANFYAAsnnt 147 Ralstonia solana...
ZP_00857314 136 ---------------------lptsAVANYATGGAMSggtnvgnlfg----------stgpvlpgtGTEIGVFLAAggrf 184 Bradyrhizobium s...
ZP_01400899  97 -------dkdassgagtepgrarilGGNGYAEGGARVlqrpmqsgv-----------gnnaivlsvTEQLDAHLSKngkf 158 Verminephrobacte...
ZP_01405287  85 ---------lcahylfngasftvnpACTNYAVGGGRInnptap-----------------napasiTQQIKDAGSAgfs- 137 Acidovorax avena...
Feature 1                     #                                                                 
P40601      111 -adhnGMYVHWIGGNDVdaalrnpa------------------------------------------------------- 134 Photorhabdus lum...
YP_521482   166 --tgnELITVLAGPNDLfaqltkltvdataagnaagntafatavvgalaadstnpataataigtampqaqaaaakvagat 243 Rhodoferax ferri...
YP_523951   174 -fsgnELVSVVVGANEVtlqltllvggakaaataavtaavpaqiqadilagtcipanpq--------------------- 231 Rhodoferax ferri...
ZP_00243916 152 -fsggELVLVLAGGNDVfmnlaavgaaqi--------------------------------------------------- 179 Rubrivivax gelat...
NP_949194   160 --sstDLVTVSIGGNDSslltssvasatalgiaaag-------------------------------------------- 193 Rhodopseudomonas...
ZP_01397947 121 --akdDLVLMNGGLSDLiagmaavnlgt---------------------------------------------------- 146 Verminephrobacte...
CAD14110    148 fngnnDVVFVLAGSNDIffwttaaatsgs--------------------------------------------------- 176 Ralstonia solana...
ZP_00857314 185 -gprdLVDITTAGGNDSvpilfnptit----------------------------------------------------- 210 Bradyrhizobium s...
ZP_01400899 159 --apnHLVIITGGGNDSyaqfaalcwqldnng------------------------------------------------ 188 Verminephrobacte...
ZP_01405287 138 ---dgDLVLIDGGGNDAadiigaylrvprdggaayrallltql------------------------------------- 177 Acidovorax avena...
Feature 1                                                                                       
P40601          --------------------------------------------------------------------------------     Photorhabdus lum...
YP_521482   244 tttimqaavtgavqaaalagntkvmdmtyingvvttakdfataagtaagnqtfagtligalaadattpatagpiiqtafv 323 Rhodoferax ferri...
YP_523951       --------------------------------------------------------------------------------     Rhodoferax ferri...
ZP_00243916     --------------------------------------------------------------------------------     Rubrivivax gelat...
NP_949194       --------------------------------------------------------------------------------     Rhodopseudomonas...
ZP_01397947     --------------------------------------------------------------------------------     Verminephrobacte...
CAD14110        --------------------------------------------------------------------------------     Ralstonia solana...
ZP_00857314     --------------------------------------------------------------------------------     Bradyrhizobium s...
ZP_01400899     --------------------------------------------------------------------------------     Verminephrobacte...
ZP_01405287     --------------------------------------------------------------------------------     Acidovorax avena...
Feature 1                                                                                       
P40601          --------------------------------------------------------------------------------     Photorhabdus lum...
YP_521482   324 teaakgsamnvvvgaaaaaaagqgntkvvtdptyvptlvanattaanaagaaagatafatklagllaadatvpatagpai 403 Rhodoferax ferri...
YP_523951       --------------------------------------------------------------------------------     Rhodoferax ferri...
ZP_00243916     --------------------------------------------------------------------------------     Rubrivivax gelat...
NP_949194       --------------------------------------------------------------------------------     Rhodopseudomonas...
ZP_01397947     --------------------------------------------------------------------------------     Verminephrobacte...
CAD14110        --------------------------------------------------------------------------------     Ralstonia solana...
ZP_00857314     --------------------------------------------------------------------------------     Bradyrhizobium s...
ZP_01400899     --------------------------------------------------------------------------------     Verminephrobacte...
ZP_01405287     --------------------------------------------------------------------------------     Acidovorax avena...
Feature 1                                                                                       
P40601      135 -----------------------------------------------------------------------------daq 137 Photorhabdus lum...
YP_521482   404 gaamaaakatasaapgatadsvntavvtaavqaaaaagntkvmnmtyinaiaasaqasattagtaagnqyvattgaanag 483 Rhodoferax ferri...
YP_523951   232 -------------------------------------------asncvstavaeltptvgaaaantylsptgpavaaavt 268 Rhodoferax ferri...
ZP_00243916 180 -------------------------------------------------------------------------tptdavv 186 Rubrivivax gelat...
NP_949194   194 ------------------------------------------------------------------ravngtgvaplsgt 207 Rhodopseudomonas...
ZP_01397947 147 -------------------------------------------------------------------------qteaaql 153 Verminephrobacte...
CAD14110    177 ------------------------------------------------------------------------gvtpaiat 184 Ralstonia solana...
ZP_00857314 211 ---------------------------------------------------------------------------qdqmn 215 Bradyrhizobium s...
ZP_01400899 189 ---------------------------------------------------------------------dggkttmagav 199 Verminephrobacte...
ZP_01405287 178 ----------------------------------------------------------daatvanafaagaaglaqaggl 199 Acidovorax avena...
Feature 1                                                                                       
P40601      138 kiitESAMAASSQVHALLNAGAGLVIVPTVPDVGMTPKimefvlskggatskdlakihavvngyptidkdtrlqvihgvf 217 Photorhabdus lum...
YP_521482   484 vgvvTAAATLAGYVKDMVNKGAKHVVVLNLPDMSLTPSarstiiynadgsik---------------------------- 535 Rhodoferax ferri...
YP_523951   269 amatAASDLVNNVNTLILAKGAKYVLVASIPDLADIPAlaaysaaqk--------------------------------- 315 Rhodoferax ferri...
ZP_00243916 187 amatAGGELAAYVRSQLVGNGARHVVVVNLPDVSQTPFayslaaptq--------------------------------- 233 Rubrivivax gelat...
NP_949194   208 ydgvTYNNVVTSGVHQLVDAGARNIAWLSAGNSKYFPVpegggaigd--------------------------------- 254 Rhodopseudomonas...
ZP_01397947 154 aaafQAGQDMAAQVRRLVAAGARHVLLTGSYDLGKTPWakvmgrea---------------------------------- 199 Verminephrobacte...
CAD14110    185 aqvqQAATDLVGYVKDMIAKGATQVYVFNLPDSSLTPDgvasgttgq--------------------------------- 231 Ralstonia solana...
ZP_00857314 216 taarQTTANILSDVQQVVQAGARNIAILSVGDLSYLPAgagna------------------------------------- 258 Bradyrhizobium s...
ZP_01400899 200 aamdKAASDQVANIRRIKDAGAGVILVSLASDWSVNPFakkylsaaytg------------------------------- 248 Verminephrobacte...
ZP_01405287 200 ymqaLATQFAGTIRSNVLEKGAKRVAVLNAPGVTLTPRfrfvlagvaaangaa--------------------------- 252 Acidovorax avena...
Feature 1                                                                                       
P40601      218 kqigsdvsggdakkaeettkqlidgynelssnasklvdnYNQLEDMALSQENGn------IVRVDVNALLHEvi---aNP 288 Photorhabdus lum...
YP_521482   536 -------------------------dnssqrlvlalvkaFNAELQKDLGVTLGvpa--ngVLLVDFFTNMQNnv---nDP 585 Rhodoferax ferri...
YP_523951   316 ------------------------------slvdamvitFNSTLKAGLTALPGna----nVIYLDTYTSIKDei---tNP 358 Rhodoferax ferri...
ZP_00243916 234 ------------------------------gliaqmsiaFNVSLANGLNDASGv-----lLVDAYSRGREQVa-----NP 273 Rubrivivax gelat...
NP_949194   255 ------------------------------aardafahtYYQQIQLLLRPMAQag---vrIFLFDFEILQARiy---aNP 298 Rhodopseudomonas...
ZP_01397947 200 -------------------------------vlgrassrFNEGLLLGIVDLGAn------ALYVDSAYYVNLyt---gSP 239 Verminephrobacte...
CAD14110    232 ------------------------------allhalvgtFNTTLQSGLAGTSAr------IIDFNAQLTAAIq-----NG 270 Ralstonia solana...
ZP_00857314 259 ----------------------------------nvhyfQSTLTQMEQASLAPlarsgvrIFFFDLATLTQRvv---aNP 301 Bradyrhizobium s...
ZP_01400899 249 -----------------------------ckqavsaaqiTAWTEQFNQRIRDGlr----gVAGVVFFTTHEVyraasaNP 295 Verminephrobacte...
ZP_01405287 253 ------------------------aatqaaavfdgwvqaFNARLGASLSGDSR-------VTVVDFYSNFKDqa---tNP 298 Acidovorax avena...
Feature 1                                                                 #  #                 
P40601      289 LRYGFLNTIgyacaqgvnagsc--------------------rskdtgfdaskpFLFADDFHPTPEAHHIVSQYTVSVL 347 Photorhabdus lumi...
YP_521482   586 GHYALTNTKdvacnltapanalatvgld-------dgsslvcngsnliagdtshYMFADKVHPTPYSHKLLSQVVNKIM 657 Rhodoferax ferrir...
YP_523951   359 AKYLLTNTKaqacdpaltpqnrall--------------cnastliagqtadshYLFADDQHPTPYGYLLFATYVLQQM 423 Rhodoferax ferrir...
ZP_00243916 274 GTFGVTNVTtpacdlaatalngfvlg------------slgcsettliagdvshYQFADGVHPTPYGHQLLANYVLDRM 340 Rubrivivax gelati...
NP_949194   299 AQYGFAADPlcqqss---------------------------------aphsptCFYQNAVHPTAAAMTLIGNYMANQI 344 Rhodopseudomonas ...
ZP_01397947 240 SSYGFNNATdavctsvdasngigigpgq-------inaalcnsatlrpdakqdtYVFADFVHLTPSAQRQFGTFAYDRL 311 Verminephrobacter...
CAD14110    271 ASFGFANTSaracdatkinalvpsagg---------sslfcsantlvasgadqsYLFADGVHPTTAGHRLIASNVLARL 340 Ralstonia solanac...
ZP_00857314 302 SFYGFTNVTtactdvpscv--------------------------ggsvaaqnqFLSYDGLHFTTAGFALIGRYQTNQI 354 Bradyrhizobium sp...
ZP_01400899 296 QGHGLVNVTdaacnntrptnsaaf----------------ctratlvapdadqtYMWSDSFHGTPGMHKLLSDKALAML 358 Verminephrobacter...
ZP_01405287 299 AQYQLTNATtpvcpatgvdsdglptynfptctaaalsaatppagatggadwwksYGFADSFHPTPYGHQLIGQLVARSL 377 Acidovorax avenae...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap