1E1Q,1C9K,1E0J,1FX0,1G18,1G64,1G6O,1G8Y,1GKI,1N0W,1PVO


Conserved Protein Domain Family
RecA-like_NTPases

?
cd01120: RecA-like_NTPases 
Click on image for an interactive view with Cn3D
RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Statistics
?
PSSM-Id: 238540
View PSSM: cd01120
Aligned: 21 rows
Threshold Bit Score: 47.4944
Threshold Setting Gi: 21465446
Created: 7-Mar-2002
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 9 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Comment:contains Walker A and Walker B motifs
  • Structure:1C9K_C; CobU bound to GMP and pryophosphate using 3.5A
    View structure with Cn3D
  • Structure:1C9K_C; CobU bound to GDP (paper)
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            #   ###                            # ##                                   
1E1Q_A     164 RELIIGDrqtGKTSIAIDTIinqkrfndg--tdekkklyCIYVAIgqkrstvaqlv------------------------ 217
1C9K_C       1 MILVTGGarsGKSRHAEALIgda--------------pqVLYIATsqilddemaar------------------------ 42
1FX0_B     167 KIGLFGGagvGKTVLIMELInniak---------ahggvSVFGGVgertregndlymem--------------------- 216
1G18_A      62 VIEIYGPessGKTTVALHAVanaqa----------aggvAAFIDAehaldpdya-------------------------- 105
1G8Y_A      32 VGALVSPggaGKSMLALQLAaqiaggpdllevgelptgpVIYLPAedpptaihhrlhal--------------------- 90
1GKI_A      55 HLLVNGAtgtGKSVLLRELAytgll----------rgdrMVIVDPngdmlskfgrdkdiilnpydqrtkgwsffneirnd 124
1N0W_A      26 ITEXFGEfrtGKTQICHTLAvtcqlpid----rgggegkAXYIDTegtfrperllava---------------------- 79
1PVO_A     173 RGLIVAPpkaGKTMLLQNIAqsiayn--------hpdcvLMVLLIderpeev---------------------------- 216
gi 2493103 151 KLPIFSGsglPHNQLAAQIArqakvrg------egekfaVVFAAMgitseeanffm------------------------ 200
gi 2493149 159 KLGIFAGsgvGKSTLMGMITrgcl------------apiKVIALIgergreipef------------------------- 201
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      
1E1Q_A         --------------------------------------------------------------------------------
1C9K_C         --------------------------------------------------------------------------------
1FX0_B         --------------------------------------------------------------------------------
1G18_A         --------------------------------------------------------------------------------
1G8Y_A         --------------------------------------------------------------------------------
1GKI_A     125 ydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrgflegtlaeslfagsneas 204
1N0W_A         --------------------------------------------------------------------------------
1PVO_A         --------------------------------------------------------------------------------
gi 2493103     --------------------------------------------------------------------------------
gi 2493149     --------------------------------------------------------------------------------
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      
1E1Q_A     218 --------------------------krltdadamkYTIVVSatasdaaplqylapy----sgcsmgeyfrdngkhALII 267
1C9K_C      43 --------------------------iqhhkdgrpaHWRTAEcwrhldtl------------------itadlapdDAIL 78
1FX0_B     217 ----------------------kesgvineqniaesKVALVYgqmneppgarmrvglt---altmaeyfrdvneqdVLLF 271
1G18_A     106 ----------------------------kklgvdtdSLLVSQpdtgeqalei--------------admlirsgalDIVV 143
1G8Y_A      91 ----------------------gahlsaeerqavadGLLIQPligslpnimape----------wfdglkraaegrRLMV 138
1GKI_A     205 kaltsarfvlsdklpehvtmpdgdfsirswledpngGNLFITwredmgpalrplisawvdvvctsilslpeepkrrLWLF 284
1N0W_A      80 ------------------------eryglsgsdvldNVAYARafntdhqtqlly-----------qasaxxvesryALLI 124
1PVO_A     217 -----------------------------temqrlvKGEVVAstfdepasrhvqvae----mviekakrlvehkkdVIIL 263
gi 2493103 201 --------------------------eefrktgaleRAVVFInladdpaieriltpri---altvaeylayekdmhVLVI 251
gi 2493149 202 --------------------------ieknlkgdlsSCVLVVatsddsplmrkygaf----camsvaeyfknqgldVLFI 251
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1       ##                                                                             
1E1Q_A     268 YDDLskqavayrqmslll--rrppgreaypgdvfYLHSRLLeraakmndafgggsltALPVIEtqagdvsay-------- 337
1C9K_C      79 LECIttmvtnllfalggendpeqwdyaameraidDEIQILIaacqr-------cpakVVLVTNevgmgivpenrlarhfr 151
1FX0_B     272 IDNIfrfvqagsevsall--grmpsavgyqptlsTEMGSLQeritst----kegsitSIQAVYvpaddltdp-------- 337
1G18_A     144 IDSVaalvpraelegem----gdshvglqarlmsQALRKMTgalnn-------sgttAIFINQlrdkigvmfgspe---- 208
1G8Y_A     139 LDTLrrfhieee---------------nasgpmaQVIGRMEaiaad-------tgcsIVFLHHaskgaammgagdqq--- 193
1GKI_A     285 IDELasl------------------------eklASLADALtkgrk-------aglrVVAGLQstsqlddvygv------ 327
1N0W_A     125 VDSAtalyrtdysgr--------gelsarqxhlaRFLRXLLrlade-------fgvaVVITNQvvaqvdgaaxfaad--- 186
1PVO_A     264 LDSItrlarayntvvpas---gkvltggvdanalHRPKRFFgaarnve---eggsltIIATALidtgskmdev------- 330
gi 2493103 252 LTDMtnycealreisaar--nevpgrrgypgymyTDLATIYeragrvk--grtgtitQIPILTmpdddithp-------- 319
gi 2493149 252 MDSVtrfamaqreiglal--gepptskgyppsalSLLPQLMeragkee---nkgsitAFFSVLvegddlsdp-------- 318
                      330       340
               ....*....|....*....|..
Feature 1                            
1E1Q_A     338 -----iptnvisitDGQIFLET 354
1C9K_C     152 diagrvnqrlaaaaDEVWLVVS 173
1FX0_B     338 -----apattfahlDATTVLSR 354
1G18_A     209 --tttggkalkfyaSVRMDVRR 228
1G8Y_A     194 -qasrgssvlvdniRWQSYLSS 214
1GKI_A     328 ----keaqtlrasfRSLVVLGG 345
1N0W_A     187 pkkpiggniiahasTTRLYLRK 208
1PVO_A     331 -----iyeefkgtgNMELHLSR 347
gi 2493103 320 -----ipdltgyitEGQIVLSR 336
gi 2493149 319 -----iadqtrsilDGHIVLSR 335

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap