Conserved Protein Domain Family
malate_synt_G

?
cd00728: malate_synt_G 
Click on image for an interactive view with Cn3D
Malate synthase G (MSG), monomeric enzyme present in some bacteria. In general, malate synthase catalyzes the Claisen condensation of glyoxylate and acetyl-CoA to malyl-CoA , which hydrolyzes to malate and CoA. This reaction is part of the glyoxylate cycle, which allows certain organisms to derive their carbon requirements from two-carbon compounds, by bypassing the two carboxylation steps of the citric acid cycle.
Statistics
?
PSSM-Id: 238370
View PSSM: cd00728
Aligned: 10 rows
Threshold Bit Score: 1324.73
Threshold Setting Gi: 68231414
Created: 6-Mar-2002
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
active site
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1D8C_A        9 RLRIDANFKRFVDEEVLPgtGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSnpgpvkDKAAYKSFLREL 88
1N8I_A        9 NLRIARVLYDFVNNEALPgtDIDPDSFWAGVDKVVADLTPQNQALLNARDELQAQIDKWHRRrviepiDMDAYRQFLTEI 88
gi 22988727  13 GLQVAANLDQFVETEALPgtGLDSAAFWSGFDALVHELAPKNRALLAERDRLQTELDNWHRAnpgpvrDLRAYRAFLEGI 92
gi 14024664   9 GLRIAGELHDFVAGEALPgtGIAADAFWSGFSAIVHDLAPKNRALLKKRDAMQERLDGWYRDnga-pvDMEVYKSFLKEI 87
gi 56379910   9 NIQVAKVLYDFVNEELLPnsGLDQDKFWSDFGALISDLTPRNKELLARRDEIQEKLNEWHKAhrg-rfDFNEYKAFLTDI 87
gi 71144634   9 GYKVAGCLYNLVNHEVLPglNIHADDFWNSVAEVLAEFTPRNQQLLATRANLQAHIDVWHTDpanqpfNQQRYELFLKEI 88
gi 71148087   9 NLTVSQCLFDFIENEALPdtSISSSHFWQQFSSIIHDLSPENKQLLLKRDALQASINSYHQDnk--plDFSHYKKFLADI 86
gi 91762354  13 NLSVSNKLLNFVNEELLKdtNISSEKFWEGFDQVVHELAPKNKELLKIREDLQKKIDDWHIAnkgneiNLEEYKKFLKEI 92
gi 76791309   9 QLQVAPQLAAFIEEQALPssEVAPTEFWAGFSNILAQLTPVNDALLAKRDLLQQKIDAYCQShp--tlEPASYKTFLQEI 86
gi 68231414   9 GLRVASELHQFVAEEALPgsGVDQAAFWAGATEIINDLTPRNRELLARRDELQQAVDDYHRRtpg-rpAQSDYAEFLTSI 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1D8C_A       89 GYLVPQPERVTVETtgIDSEITSQAGPQLVVPAXNARYALNAANaRWGSLYDALYGSDIIPQega--xvsGYDPQRGEQV 166
1N8I_A       89 GYLLPEPDDFTITTsgVDAEITTTAGPQLVVPVLNARFALNAANaRWGSLYDALYGTDVIPEtdgaekgpTYNKVRGDKV 168
gi 22988727  93 GYIVPVPASVKATTdhVDTEIAEQAGPQLVVPLSNQRYALNAANaRWGSLYDALYGTDAIPEangaekqkAFNPVRGAAV 172
gi 14024664  88 GYLVPEGPAFSVSTdnVDPEIAVVAGPQLVVPVMNARYALNAANaRWGSLYDALYGTDAIPEtggaekgkGFNPARGAKV 167
gi 56379910  88 GYLEPEVEDFEITTdnVDDEIAVQAGPQLVVPLTNARYALNAANaRWGSLYDALYGTDAISEedgaergsSYNPVRGAKV 167
gi 71144634  89 GYLVTEKADFTISTqnVDDEVALIAGPQLVVPLMNARFSLNAANaRWGSLYDALYGTDVIGDdngakqtkDFNPIRGRRV 168
gi 71148087  87 NYLVPQVDDFSINTsnVDNELALMAGPQLVVPIMNARFALNAVNaRWGSLYDALYGTDVISHengaqpgkTYNPVRGKKV 166
gi 91762354  93 DYLKEVGPDFKIKTnnVDEEITSIAGPQLVVPIMNERYALNAANaRWMSLYDSLYGTDVIDQseds-atqRYDPLRGEMV 171
gi 76791309  87 GYLETPPADFSITTdnVDDEVATMAGPQLVVPINNARFALNAANaRWGSLYDAAYGTDVIPEdngatrtkAYNPARGQQV 166
gi 68231414  88 GYLLDEPAPFTITTdgVDDEIATQAGPQLVVPLLNARYAVNAANaRWGSLYDALYGSDVIDEtdgreragGYNPTRGAAV 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1D8C_A      167 IAWVRRFLDESLPLEnGSYQDVVAFKVVDKQLRIQLKNgKETTLRTPAqFVGYRGDAaAPTCILLKNNGLHIELQIDAnG 246
1N8I_A      169 IAYARKFLDDSVPLSsGSFGDATGFTVQDGQLVVALPD-KSTGLANPGqFAGYTGAAeSPTSVLLINHGLHIEILIDPeS 247
gi 22988727 173 IAYARRFLDQAAPLAnGSHADATRYGVEGGKLVVTLKN-GTSELKTPAqFIGYQGEEsAPSAVLLKHNGLHFEIQIDAnD 251
gi 14024664 168 IAWAKDFLDQSVPLTsGKWAGVNGLSVAHGALKLGAGA-GGTTLADPRqFAGYRGDAaNPDAVLLVKNGLHIEIVVDRnN 246
gi 56379910 168 IAYGRQFLDEAVPLAqYSHKDAVQYAIVDGQLVVTTEGgATTGLKEPEkFVGFQGDPqHPTAVLLKNNGLHIEIQIDReH 247
gi 71144634 169 QAYARRFLDETLPLTrGSHIDAVKYHIVKKAFTVTLFTgEQVQLKEAQqFVGYKGSTaAPSILLCRHNGLHIEIQIDKdN 248
gi 71148087 167 IAFAKGYLDQAIPLLtGNHSQAISYHLTEHQLMVSLADgQQSPLKDPSaFIGFTGSInKPDSLMFTHNGLHLNLLFSDdS 246
gi 91762354 172 IKYGRDFLEKYFPLEnFEWHNITGFKIDNGSLTVLKDS-NKSSLKNKDkYIGHRGEAnDPSAIILKNNNLHIEIIIDPnA 250
gi 76791309 167 IQYARKWLDVIAPLTnGSHTTSQGYDITSGQLVVTLADaSTATLSHPTqLLGFVGDKnNPSAILLQHNGLHVELQFDRtH 246
gi 68231414 168 IARVREILDRSFPLTsGSHADATRYAVDADGLVVTVDG-AAVRLADPAlFVGFRGEGdEPTAVLLTHHGLHVEIQVDRnH 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1D8C_A      247 RIGKDDpaHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLXQGTLQEKXEKNGRQIVRKLNDDRHYTAa-dGS 325
1N8I_A      248 QVGTTDraGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLAAAVDKDGTAFLRVLNRDRNYTAp-gGG 326
gi 22988727 252 SIGKTDsaHVKDVVVEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMNGDLTEEVTKNGKTFTRRLNADRVYTAangTA 331
gi 14024664 247 QIGRTDpaGIADVILESALTTIQDCEDSVAAVDAQDKVVVYRNWLGLMKGDLAEEISKAGRSFVRKLNADRAYTAp-aGG 325
gi 56379910 248 AVGKTDqaGVKDIVLEAAVTTIMDGEDSVAAVDAEDKVLVYRNLFGLVKGDLTATFEKNGKIMTRSLNPDRVYKTp-dGG 326
gi 71144634 249 VVGKTDaaAVKDVVLESALSTIQDCEDSIAAVDASDKTSVYRNWLGLMKGDLAEIIQKGSRTITRTLNHDRNYLSp-dQK 327
gi 71148087 247 AIGKEDaaGLSDVVLESALTTIMDCEDSVAAVDGEDKVIAYRNWLGLMTGKLSAKLNKNGKTITRTMNNDLSVQTl-tGD 325
gi 91762354 251 FSAQQDpaKISDIIVEAAVSTICDNEDSVAAVDADDKVICYRNWLGLMKGDLKSTFEKNGKTYERKLNPDRSYISk-dGK 329
gi 76791309 247 QIGQSDpcGMKDILVESALTTIMDCEDSVAAVDAEDKTLVYQNWLGLIKGTLEVSLSKPGGSSVRRLSADRNYTTl-tGK 325
gi 68231414 247 PVGAGDraGVSDVVVEAAVTTIMDLEDSVAAVDAADKVLGYRNWLQLMQRRLTAEVDKGGRTFTRVLAADREYTTa-dGG 325
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #                                                                   
1D8C_A      326 EISLHGRSLLFIRNVGHLXTIPVIWdsegnEIPEGILDGVXTGAIALYDLkv------qkNSRTGSVYIVKPKXhgPQEV 399
1N8I_A      327 QFTLPGRSLMFVRNVGHLMTNDAIVdtdgsEVFEGIMDALFTGLIAIHGLkasdvngpliNSRTGSIYIVKPKMhgPAEV 406
gi 22988727 332 PVVLHGRSLLFIRNVGHLMTNPAVLtkdghEIPEGILDAVITSLCALHDRkh------klNSRTGSIYIVKPKMhgPAEV 405
gi 14024664 326 QITVPGRSLMLVRNVGHLMTNPAILdrdgnEVPEGIMDAALTALIALHDVgpeg---rraNSRAGSMYVVKPKMhgPEEV 402
gi 56379910 327 ELVLPGRSLMFVRNVGHLMTNNAILhangeEVHEGIMDAVITSLIMKHSLignt---rylNSRKGSIYIVKPKMhgSAEV 403
gi 71144634 328 EITLPGRSLQFIRNVGHLMTTNAIVtakneKVPEGIVDGLITSLISLHDLkgts---kfkNSKQGSIYIVKPKMhgPEEV 404
gi 71148087 326 TVTLKGRSLMFVRNVGHLMTNNAIIdsqgnEVPEGILDAMITSLIALHDLkgns---afsNSSEGSIYIVKPKMhgPEEV 402
gi 91762354 330 GLKLHGRSLLLVRNVGHLMTNSAITlkdgsEIPEGIMDAFITSAACLHDIkk------kgNSRTGSIYIVKPKMhgPDET 403
gi 76791309 326 SFSLNGRSMMFVRNVGHLMTNDAILfq-gkPIYEGIMDAVITSLIAKHDLlgng---qyrNSKAGSIYIVKPKMhgSEEV 401
gi 68231414 326 TVTLPGRSMLLIRQVGLLMTTDAVLdrdgrPVPEGILDALVTGLGSVHDLrgdt---aggNSRTGSAYVVKPKMhgPDEV 402
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                  #                         # #                        
1D8C_A      400 AFANKLFTRIETXLGXAPNTLKXGIXDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEXHSVXEAGPXLRKNQXKST 479
1N8I_A      407 AFTCELFSRVEDVLGLPQNTMKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRKGTMKSQ 486
gi 22988727 406 AFASELFARVEDLLKLPRNTIKMGIMDEERRTSVNLLACINEARERVAFINTGFLDRTGDEMHTAMEAGPMLRKGDMKSS 485
gi 14024664 403 AFAVEIFDRVEALLGMPRNTIKMGIMDEERRTTVNLKEAIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQA 482
gi 56379910 404 AFANELFDRVEDMLGLERNTIKIGVMDEERRTSLNLKNCIYQVRDRIIFINTGFLDRTGDEIHTSMEAGPMLRKNEMKSS 483
gi 71144634 405 AFSHDLFSAIERHLGLAQNTIKMGIMDEERRTSANLKECIRAAQTRLAFINTGFLDRTGDEIHTSMHAGAMAQKALMKDE 484
gi 71148087 403 AFANTLFSRVETALSLPQNTVKMGIMDEERRTSVNLKNCIFAAKDRVVFINTGFLDRTGDEIHTSMMAGPMARKADIKLT 482
gi 91762354 404 SFTDLIFTKVEEVLGLEKYTCKIGIMDEERRTSSNLKECIRTLQNRVFFINTGFLDRTGDEMHTSMEAGPMIKKGDMKSS 483
gi 76791309 402 AFADTLFSQVEDALALPKNTLKMGIMDEERRTSVNLKACINAAKARAVFINTGFLDRTGDEIHTSMHLGPFALKADIKQQ 481
gi 68231414 403 AFTVELMSRVERLLQLPPATIKLGIMDEERRTSVNLRRCVYEARDRVVFINTGFLDRTGDEIHTSMLAGPMVRKAAMREA 482
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1D8C_A      480 PWIKAYERNNVLSGLFCGLrGKAQIGKGXWAXPDLXADXYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTNVQSVQAN 559
1N8I_A      487 PWILAYEDHNVDAGLAAGFsGRAQVGKGMWTMTELMADMVETKIAQPRAGASTAWVPSPTAATLHALHYHQVDVAAVQQG 566
gi 22988727 486 AWIAAYERSNVLVGLSAGLrGRSQIGKGMWAMPDLMHAMLEQKIAHPKAGANTAWVPSPTAATLHALHYHQVDVQAVQQE 565
gi 14024664 483 AWISAYEAWNVDTGLECGLaGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHKVDVHAVQAA 562
gi 56379910 484 TWLQAYEKSNVAVGLAAGFrGRAQIGKGMWAMPDLMAEMLKQKGAQLKAGANTAWVPSPTAATLHALHYHQVNVSAVQSE 563
gi 71144634 485 PWITAYENRNVRIGLQAGLqGKAQIGKGMWAIPDQMSEMVKSKIAHPKSGANCAWVPSPTAATLHVMHYHKVNVQEIQSA 564
gi 71148087 483 PWIGAYEDNNVDVGLACGFsQKAQIGKGMWPIPDQMANMIATKINHVEAGANTAWVPSPTAATLHSLHYHRVNVFELQKQ 562
gi 91762354 484 KWIGAYENNNVDIGLQCGLsGKAQIGKGMWAMPDKMKEMMEQKTGHLNAGANCAWVPSPTAAALHALHYHEINIFEKQKE 563
gi 76791309 482 PWLTAYELANVKIGVDAGMsGKAQIGKGMWPIPDNMADMMQSKTNHPQSGANTAWVPSPTAATLHALHYHQIDVFSLRNP 561
gi 68231414 483 TWIRVYEDNNVDAGLALGFpGRAQIGKGMWAAPDNLADMMTQKIGHPLAGASCAWVPSPTAAALHALHYHEVSVADRQRE 562
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                               #       
1D8C_A      560 IaqtefnaefeplLDDLLTIPVAenan-wsaQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPDIHNVALXEDRATLRIS 638
1N8I_A      567 Lagkr-----ratIEQLLTIPLAkela-wapDEIREEVDNNCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRIS 640
gi 22988727 566 LertdyakvrdelLDGLLTIPVVaeak-wsdDEIRSEIDNNAQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRIS 644
gi 14024664 563 Lksrp-----kakLDDILSVPVAvrpn-wtpDEIQRELDNNAQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRIS 636
gi 56379910 564 Landr-----ndyRDDMLQIPVVdhpq-wtaEEIQEELDNNCQSILGYVVRWIDQGIGCSKVPDIHNVGLMEDRATLRIS 637
gi 71144634 565 MqaefslpgtiddLSELLTIPLLknqtelstAAIQKELDNNIQGLLGYVVRWVNQGIGCSKVPDIDNIARMEDRATLRIS 644
gi 71148087 563 Lakrq-----panIDDILTIPLAehtn-wteQEISDELDNNCQGILGYVVRWIDDGVGCSKVPDINNVGLMEDRATLRIS 636
gi 91762354 564 Iqkre-----sakLDDLLTIPVAdrpn-wsmEEINSEISNSAQTLLGYVVRWIDHGVGCSKVPDINNVGLMEDRATLRIS 637
gi 76791309 562 Iasnd-----fdgLDDILTVPLLadcsslsqQDIQHELDNNVQGILGYVVRWVHQGIGCSKVPDINNVGLMEDRATLRIS 636
gi 68231414 563 Lagrr-----padRLELLTVPLAepaaawspEEVAAEVDNNVQGVLGYVVRWVELGIGCSKVPDLTGTPLMEDRATCRIS 637
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1D8C_A      639 SQHIANWLRHGILtkEQVQASLENXAKVVDQQNAG--------DPAYRPXAGNfanSCAFKAASDLIFLGVKQPNGYTEP 710
1N8I_A      641 SQLLANWLRHGVItsADVRASLERMAPLVDRQNAG--------DVAYRPMAPNfddSIAFLAAQELILSGAQQPNGYTEP 712
gi 22988727 645 SQHIANWLYHGVVkrELVEETFRRMARVVDEQNAG--------DPLYKPMAPGf-dTIAFKAAQALVFEGRQQPSGYTEP 715
gi 14024664 637 SQHIANWLRHKVCseIQVRDSLQRMAAIVDRQNVG--------DPLYRPMAPDfdkSIAFQAACDLVFKGTSQPNGYTEP 708
gi 56379910 638 SQILANWLHHGICtkEQVLETLKRMAKVVDEQNAG--------DPNYRPMAPNyddSVAFQAACDLIFRGYEQPNGYTEP 709
gi 71144634 645 SQHVCNWLHHGVIsdSQVLESLQRMAEVVDQQNAA--------DSSYIAIGTDfgeSIAFKAAKDLIFQGKEQPSGYTEP 716
gi 71148087 637 SQHIANWLTHNICtiEQVQASLEKMANIVDKQNAS--------DSSYQAMSNDftnSIAFKAAAALIFSGVEQPNGYTEP 708
gi 91762354 638 SQHIANWIHHDICtkSQVMEVMKKMAKIVDDQNKNdgaytrsgRGSYEMMSENfdqSIAFKTACDLIFKGKEQPSGYTEP 717
gi 76791309 637 SQHIANWLLHGLIneAQINDSMLRMAQLVDAQNSS--------DKEYIPMMPDpikSIAFQAAQELILQGTQQPNGYTEP 708
gi 68231414 638 SQHVANWLRHGIVsrEQVEESLRRMAALVDAQNAG--------EPGYRPMAPAf-eELAFAAARALLLEGADQPNGYTEP 708
                       730
                ....*....|
Feature 1                 
1D8C_A      711 LLHAWRLREK 720
1N8I_A      713 ILHRRRREFK 722
gi 22988727 716 LLHKFRLEVK 725
gi 14024664 709 VLHARRLELK 718
gi 56379910 710 ILHRRRQEAK 719
gi 71144634 717 LLHQRRQEVK 726
gi 71148087 709 LLHQYRLEKK 718
gi 91762354 718 LLHLNRLIKK 727
gi 76791309 709 VLHAKRREMK 718
gi 68231414 709 LLHEHRRAQK 718

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap