Conserved Protein Domain Family
SAHH

?
cd00401: SAHH 
Click on image for an interactive view with Cn3D
S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains
S-adenosyl-L-homocysteine hydrolase (SAHH, AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy). The equilibrium lies far on the side of AdoHyc synthesis, but in nature the removal of Ado and Hyc is sufficiently fast, so that the net reaction is in the direction of hydrolysis. Since AdoHyc is a potent inhibitor of S-adenosyl-L-methionine dependent methyltransferases, AdoHycase plays a critical role in the modulation of the activity of various methyltransferases. The enzyme forms homotetramers, with each monomer binding one molecule of NAD+.
Statistics
?
PSSM-Id: 240619
View PSSM: cd00401
Aligned: 108 rows
Threshold Bit Score: 510.846
Threshold Setting Gi: 255103871
Created: 6-Mar-2002
Updated: 1-Feb-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 25 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Structure:1K0U: Rattus norvegicus S-Adenosylhomocysteine Hydrolase bound to NAD; contacts at 4A
    View structure with Cn3D
  • Structure:1A7A: Human placental S-Adenosylhomocysteine Hydrolase bound to NAD; contacts at 4A
    View structure with Cn3D
  • Citation:PMID 9586999
  • Structure:1V8B: Plasmodium falciparum S-adenosyl-L-homocysteine hydrolase bound to NAD; contacts at 4A
    View structure with Cn3D
  • Structure:3CE6: Mycobacterium tuberculosis S-adenosyl-L-homocysteine hydrolase bound to NAD; contacts at 4A
    View structure with Cn3D
  • Comment:GxGxxG(17x)E NAD binding site motif resembles GxGxxG(17-19x)D motif typical of FDH-like proteins

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1K0U_A        15 AWGRKALDIAENEMPGLMrMREMYSASKPLKGARIAGCLHMTVETAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKa 94
gi 6094226    12 EEGLKRIEWAEMDMPVLRqIRERFSKEKPLKGKKISACLHVTTETANLMRTLKEGGAEVYLTASNPLSTQDDVAAALVKy 91
gi 21362921   19 PLGRQRIEWAGREMPVLRqIRDRFAQEKPFAGLRLVACAHITTETAHLAIALKAGGADAVLIASNPLSTQDDVAASLVLd 98
gi 170287582  25 EKGSKRILWAEKKMPVLKqIKEKFLREKPLKGKKISSCLHVTAETANLAVALKAGGAEVYLCASNPLTTQDDVAASLVKh 104
gi 206741737  13 EKGKLRIEWAEMDMPVLRmIRDRFKKEKPLKGVKLAACLHVTTETANLMITLKEGGAELALCASNPLSTQDDVASALVKy 92
gi 219544664  14 EQGRKRIEWAEKEMPVLRlIRERFARERPLAGLRISACLHVTTETANLMRTLVAGGADVVLVASNPLSTQDDVAAALVAy 93
gi 225794480  19 DQGRKRIEWANQSMPVLQsIRKDFIKNQPLKGLRISACLHVTTETANLMITLRDGGADVALCASNPLSTQDDVAASLARd 98
gi 296849664  15 DLGQDRINWAAQEMPVLRqIKERFAREKPLQGVRIAACLHVTSETANLMRALKAGGAEVALCASNPLSTQDDVAASLVIh 94
gi 319751380  27 DVGHERIVWAERDMPVLReIRARFEAEKPLNGLRMSACLHVTAETANLARTLKAGGADLVLVASNPLSTQDDVAAALVRd 106
gi 328453421  27 DRGKLRVEWARQDMPVLSgIADRFRREKPLQGLRLAACLHVTTETAVLMATLKAGGAQVVVCASNPLSTQDDVAAYLARd 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1K0U_A        95 -GIPVFAWKGETDEEYLWCIEqtlhfkdgPLNMILDDGGDLTn-LIHTKHPQLl-----------------------sGI 149
gi 6094226    92 fEIPVFAIRGEDRETYYKHLRavi---ekEPDVVIDDGADLIs-TLHKEYPGLa-----------------------eKV 144
gi 21362921   99 hEIPVFAQKGEDNATYNRHVQial---dhRPNIIIDDGSDVVatLVQERQHQIa------------------------DL 151
gi 170287582 105 yNIPVFAVKGENNETYYKHINavl---diKPQITMDDGADLVt-TVLLKRRDLl-----------------------kDI 157
gi 206741737  93 yKIPVFAIKGEDRDTYYKHIYqal---eiKPHITMDDGADLVs-TLHKEKRKLl-----------------------sHV 145
gi 219544664  94 eEIPVFAIKGESNEVYYSHIRaal---dhNPQLTMDDGADLVt-GVLKERPDLi-----------------------pHM 146
gi 225794480  99 fNIKTYAIKGEDNDTYYSHILaai---dhKPQVTMDDGCDLVt-ILHTKRKDAl-----------------------eGV 151
gi 296849664  95 dGIPVYAIKGEDKDTYYAHLEatl---asGPHFTMDDGCDLVt-LLHQQRHDLl-----------------------pGI 147
gi 319751380 107 fGVAVYAIKGEDEHSYYRHIAaal---rhLPNVTMDDGADLVs-AMIFIALGRmddlhpevrawaatlstearaklvsDV 182
gi 328453421 107 eEIPTFAIKGEDNETYYQHIQaal---diKPNITMDDGADLVf-TLHSTRQELl-----------------------pEV 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              ###                               #   #                        # ###      
1K0U_A       150 RGISEETTTGVHNLYKMmaNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQ 229
gi 6094226   145 LGGMEETTTGVIRLRAMaeQGVLKFPIIAVNDAYTKHMFDNRYGTGQSTIDGILRATNRLLAGSYFVVAGYGWCGKGVAQ 224
gi 21362921  152 IGTTEETTTGIVRLRAMfkDGVLTFPAVNVNDADTKHFFDNRYGTGQSTLDGIIRATNILLAGKNVVVVGYGWCGKGTAL 231
gi 170287582 158 IGGTEETTTGVVRLKAMakDKALAYPVIAVNDALTKHFFDNRYGTGQSTIDGIIRATNILLAGKVVVSAGYGWCGRGFAM 237
gi 206741737 146 LGGTEETTTGVIRLRAMadDGALKYPVIAVNDAYTKHLFDNRYGTGQSTIDGILRATNRLLAGSIFVVCGYGWCGRGVAM 225
gi 219544664 147 VGSTEETTTGVIRLKAMakQGVLPFPVIAVNDSDTKHMFDNRYGTGQSTLDGIIRATNILLAGKTFVVAGYGWCSRGIAE 226
gi 225794480 152 IGGTEETTTGVIRLHAMakEGVLNFPVVAVNDALTKHMFDNRYGTGQSTIDGIVRSTNVLLAGSKFVVAGYGWCGRGLAS 231
gi 296849664 148 FGGTEETTTGVIRLRAMaeDGVLAYPVIAVNDALTKHMFDNRYGTGQSTIDAILRATNVLLAGKTVVVAGYGWCGRGVAS 227
gi 319751380 183 VASMEETTTGVIRLRAMekDGVLKLPVLAVNDAETKHLFDNRYGTGQSTIDGIVRATDMLISGRRIVVVGYGWCGKGVAM 262
gi 328453421 160 FGGTEETTTGVIRLKAMaaQGVLRYPVIAVNDSQTKYMFDNRYGTGQSTVDGILRATNRLLAGSVVVVAGYGWCGRGFAM 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   ####  #                          ####  #                 ###         
1K0U_A       230 ALRGFGARVIITEIDPINALQAAMEGYEVTTMDEAckEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKW 309
gi 6094226   225 RARGMGAIVIVTEVDPIKALEARMDGFLVMPMEEAakLGDFFVTVTGNIHVIRREHFEVMKDGAIVANSGHFNVEIDIPA 304
gi 21362921  232 RARGMGANVIVTEIDPIKAIEAVMDGFRVLPMAEAapQGDIFITVTGNKHVVRGEHFDVMKDGAIVCNSGHFDLELDLKY 311
gi 170287582 238 RAKGLGAHVIVTEVDHLKAIEAAMDGFEVMPMREAaeKGDIFVTLTGNLNVIGGSHFPLMKDGAIVCNGGHFNDEIDLKA 317
gi 206741737 226 RAKGMGARVVVTEVDPLKALEAVMDGFDVMPIIDAakIGDIFVTVTGNINVISENVFSKMKNGAIVANTGHFNVEIDIEG 305
gi 219544664 227 RARGLGANVIVTEIDPVKALEAVMDGFRVMPMVEAarQADFIVTATGNKHVIDQNAFEVMKDGCVIANSGHFNVEINIPA 306
gi 225794480 232 RARGMGADVIVTEVDPTRALEAVMDGYRVMSMAEAakIGDIFCTVTGNKSVLRQEHFEAMKNGAIVANSGHFNVEIDIPA 311
gi 296849664 228 RARGMGAHVVVTEINPLKALEAVMDGFAVMPMREAarVGDIFITVTGNINVLDAQHYALMKDGAILCNAGHFNVEINIPA 307
gi 319751380 263 RARGMGGLVTVVETNPIRALEAAMDGFDVRDAKSAaaIGDLFVTVTGNMHALRGEHFALMKDGAMICNSGHFNVELALDQ 342
gi 328453421 240 RARGAGARVIITEVNPLKGLEAIMDGFQVLPMTEAapQGDIFCTLTGDINVIRQEHFLAMKDGAIACNSGHFNVELDIPG 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                         # #      #                                     
1K0U_A       310 LNenavEKVNIKPQVDRYLLkNGHRIILLAEGRLVNLGCaMGHPSFVMSNSFTNQVMAQIELWTHpdkypVGVHFLPKKL 389
gi 6094226   305 LEemavEKREIRKEVTEYKLkDGRRIYLLAEGRLVNLAAaEGHPASVMDMSFSNQALSAEYIVKHhkeleKKVYRVPREI 384
gi 21362921  312 LAanakEIKEVRPFTEEYKLtNGKSVVVLGQGRLINLAAaEGHPSAVMDMSFANQALACEYLVKNkgklaPGLHSIPVEV 391
gi 170287582 318 LKkiskSVKNVRDFVDEYTLrNNKALCVLGEGRLINLVAaEGHPASVMDMSFANQAFSVRYLVKNyknleNNVHIVPEKF 397
gi 206741737 306 LNklskSKRVIREFVEEYTLkDGRRIYLLAEGRLVNLSAaEGHPAAVMDMSFANQALSAEYIFKNakkleKKVYSVPEEI 385
gi 219544664 307 LEslsvEKRRPRAFVDQYILrDGRVINLLGEGRLVNLASaEGHPSAVMDMSFANQALASEFLLRNqgklpVGVHALPKEL 386
gi 225794480 312 LArlasSKRAGREFVDEYALrDGRKIYLLGEGRLINLAAaEGHPASVMDMSFANQALAAEYLVKNhanleKKVYSVPVDL 391
gi 296849664 308 LEsaarEKRMGRPFIEQYTVeGGRSINLLAEGRLVNLAAaEGHPSAVMDMSFANQALSVEYMLQHkgqmkAGVYPVPEAI 387
gi 319751380 343 LKeqstEIKRVRQFVEEYQLkNGRKLYVLGEGRLINLAAaHGHPASVMDMSFAAQALATEWALKNkgrlgHTVHNVPKEV 422
gi 328453421 320 LEavtvGRRHIREFVEEFTLtNGKRVNILGDGRLINLAAaEGHPSVVMDMSFANQSLAAEYISKNhdkfeKKVYMLPTEL 399
                        410       420       430
                 ....*....|....*....|....*....|
Feature 1                                      
1K0U_A       390 DEAVAEAHLGKLNVKLTKLTEKQAQYLGMP 419
gi 6094226   385 DEAVARLKLNALGIKIDELTEEQKKYLSSW 414
gi 21362921  392 DQEIARLKLQAMGIYIDSLTPEQIEYINSW 421
gi 170287582 398 DNEIASLKLNSMSIKIDVLTAEQKEYLNSW 427
gi 206741737 386 DREIARLKLESMGIKIDKLTKEQDKYLHSW 415
gi 219544664 387 DREIAALKLAAMGVTIDTLTPEQEAYLNSW 416
gi 225794480 392 DKRVARLKLEAMGIGIDRLTPEQEEYLASW 421
gi 296849664 388 DQEIARLKLEAMGMQIDTLTPEQERYLNSW 417
gi 319751380 423 DEYVATLKLQTMGITLETLTPEQKKYLESW 452
gi 328453421 400 DMEIARLKLQSMLVDIDTLTEEQVKYLSSF 429

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap