Conserved Protein Domain Family
Peptidases_S8_S53

?
cd00306: Peptidases_S8_S53 
Click on image for an interactive view with Cn3D
Peptidase domain in the S8 and S53 families
Members of the peptidases S8 (subtilisin and kexin) and S53 (sedolisin) family include endopeptidases and exopeptidases. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. Serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin. The serine residue here is the nucleophilic equivalent of the serine residue in the S8 family, while glutamic acid has the same role here as the histidine base. However, the aspartic acid residue that acts as an electrophile is quite different. In S53, it follows glutamic acid, while in S8 it precedes histidine. The stability of these enzymes may be enhanced by calcium; some members have been shown to bind up to 4 ions via binding sites with different affinity. There is a great diversity in the characteristics of their members: some contain disulfide bonds, some are intracellular while others are extracellular, some function at extreme temperatures, and others at high or low pH values.
Statistics
?
PSSM-Id: 173787
View PSSM: cd00306
Aligned: 273 rows
Threshold Bit Score: 40.646
Threshold Setting Gi: 149925058
Created: 3-Oct-2006
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitecatalytic
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:1GA4: Pseudomonas sp. Pscp binds Inhibitor Pseudoiodotyrostatin
    View structure with Cn3D
  • Structure:1R64: yeast Kex2 protease binds Ac-Arg-Glu-Lys-Boroarg peptidyl boronic acid inhibitor
    View structure with Cn3D
  • Comment:a few of the residues are conserved between S8 and S53

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                     #   
1R6V_A        156 IIVAVVDTGvdgthpd-------------------legqviAGYRpafdeelpa-------------gtdssyggSAGTH 203
gi 169613975  191 TLVYVVDRGvqvdvrdvrpflqll--httflisykdksnklFSGFedvndrftiletr----afsnqnaahdkrtDYADG 264
gi 124010196   46 INIAMLDAGiestpdlvpvhpafqgaltdnddkvphfivlsGTGRfsfsn---------------------liygRHGVL 104
gi 119622706   69 VVVTILDDGiernhpdlap------------nydsyasydvNGNDydpspry-----------------dasnenKHGTR 119
gi 154278814 1422 QHIYILEDGyykdhp--------------------efrgvdIELLfpddvnqqpw----------apevilsprvDHGAE 1471
gi 70986580   117 TYVYHVDFGaqpshpefsdvs---------flhpllpgpypVSGWm----------------------------eNDPKR 159
gi 171681375 1132 QDVYLIESGyqtdhp--------------------hflplrQNGHqetlprhl--------------sswwddnlVWYPD 1177
gi 119174789  793 IPVFIVDTGaqldhqe-------------------ftegdnIASKtefvfvekdydgqyhrddagvplngvcepgYCNPH 853
gi 7981346    278 QYIYNFDEGvnpdqdlnpnn-----------iekfhyeysiNNGRd-----------------------------MHNYI 317
gi 116200834 1142 QYIYNMDAGingnse---------------------fsganIAYFdpeys--------------------inngiGLNSY 1180
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1R6V_A        204 VAGTIAakkdgkgi-------------------------------vgvapgaKIMPIVifddpalvg----------gng 242
gi 169613975  265 HGTKVAskv-----------------------------------------vgQWGTAKgatlvpvq------------vl 291
gi 124010196  105 TAGMAAakaqvnnvaaysgvgvv------------gvapnckvvsvsqrftsDFTVFR---------------------- 150
gi 119622706  120 CAGEVAasannsycivgiaynakiggkaghgslraegpgagaagsslsaglsSLLFFGfghvttdlrqrc----tdghtg 195
gi 154278814 1472 VASKVVganlg------------------------------------fcdncKLHVAPffllgdlw-------------y 1502
gi 70986580   160 HGSLCLske----------------------------------------vgkTVGIARkatvvata-------------w 186
gi 171681375 1178 HPTGVGsvi----------------------------------------agrYTGVCPegkvrligtdvphrrwdegtds 1217
gi 119174789  854 GTGMLGmia-----------------------------------------gaNLGVAKkvkpwvvrvprk-----nkrgg 887
gi 7981346    318 HGTGVAyya----------------------------------------vgqTLGIAPgatflvmedppt-----mttnk 352
gi 116200834 1181 DHGTQValya---------------------------------------igqSLGIAPra-------------------- 1201
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                 #       
1R6V_A        243 yvgddyVAAGIiwat-----------------------------------------------dhgaKVMNHSWGgwgy-- 273
gi 169613975  292 vdefadLPDGFnqvwkdlrrr-----------------------------------kaqnrgqsiqAVVVCSVHvvpsqg 336
gi 124010196  151 ------DLAGLrqffikrdfagrkkvngllgypsiyd----vvvsprksddphqnayladlvnqtaDIFSMSIQapvde- 219
gi 119622706  196 tsvsapMVAGIialaleansqltwrdvqhllvktsrpahlkasdwkvngaghkvshfygfglvdaeALVVEAKKwtavps 275
gi 154278814 1503 erlieqLMTIQnrvrrn--------------------------------------------gfqykAVINMSFDldd--- 1535
gi 70986580   187 dfqksiNEHWLdalakvhad-------------------------------------istgargakSVVNLSISipqgdl 229
gi 171681375 1218 pvwawmLIDALtttlgrvk----------------------------------------sngrgtkSVINMSFSmi---- 1253
gi 119174789  888 gftpqhFLEGVarvndmil----------------------------------------gdskttrAILSLSWSydsekf 927
gi 7981346    353 tghleiNLIRLlgmindie----------------------------------------skgrqgkCVINISMVwv---- 388
gi 116200834 1202 ----tlVLMADdgtmdpdddqasd-----------------------------eivstlplrvyadAVVQCGCSvi---- 1244
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1R6V_A        274 ---------sytmKEAFDYAMeh-----------------------------------gVVMVVSAgnntsdshh----- 304
gi 169613975  337 g-----wtrqeaeAQFVGRMFskwikl---------------------------lheegVPIVLASgnfgdidkrdvid- 383
gi 124010196  220 --------stnkvEAFATLVFddltff--------------------------grkgrgCVLVVASgnngqvlevtag-- 263
gi 119622706  276 qhmcvaasdkrprSIPLVQVLrttaltsacaehsdqrvvylehvvvrtsishprrgdlqIYLVSPSgtksqllakrlldl 355
gi 154278814 1536 ----------dvrEACLRRIHemlat----------------------------ldswgVSIVVAVgnvdpdfpdgvfyp 1577
gi 70986580   230 t-----aaflekmALLIREIIkl-----------------------------------gAVFVTGSgnspgspngypal- 268
gi 171681375 1254 -----------vfNEPMRNMLstllqq---------------------------ldslgVVIVVASgnhpdwhnadlvpp 1295
gi 119174789  928 i-----kgsdastDDFETWRVrfhgilr-------------------------tliqkgVFVVTGSgnnhivngw----- 972
gi 7981346    389 -----------vpEDATDRWLslfrmmir-----------------------ymetnlqCVVVIASgnvediqs------ 428
gi 116200834 1245 -----------stTSSIPASWfldg-------------------------------qlpDLVVAASaskh---------- 1272
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1R6V_A            --------------------------------------------------------------------------------
gi 169613975      --------------------------------------------------------------------------------
gi 124010196      --------------------------------------------------------------------------------
gi 119622706  356 snegftnwefmtvhcwgekaegqwtleiqdlpsqvrnpekqgklkewslilygtaehpyhtfsahqsrsrmlelsapele 435
gi 154278814      --------------------------------------------------------------------------------
gi 70986580       --------------------------------------------------------------------------------
gi 171681375 1296 p------------------------------------------------------------------------------- 1296
gi 119174789      --------------------------------------------------------------------------------
gi 7981346        --------------------------------------------------------------------------------
gi 116200834      --------------------------------------------------------------------------------
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1R6V_A            --------------------------------------------------------------------------------
gi 169613975      --------------------------------------------------------------------------------
gi 124010196      --------------------------------------------------------------------------------
gi 119622706  436 ppkaalspsqvevpedeedytgvchpecgdkgcdgpnadqclncvhfslgsvktsrkcvsvcplgyfgdtaarrcrrchk 515
gi 154278814      --------------------------------------------------------------------------------
gi 70986580       --------------------------------------------------------------------------------
gi 171681375      --------------------------------------------------------------------------------
gi 119174789      --------------------------------------------------------------------------------
gi 7981346        --------------------------------------------------------------------------------
gi 116200834      --------------------------------------------------------------------------------
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1R6V_A        305 --------------------------------------------------------------qypagypgVIQVAALdyy 322
gi 169613975  384 ----------------------------------------------------------tlpavlatddvpLINVGATtve 405
gi 124010196  264 -----------------------------------------------------------qyrneyatsnkPIVVGATrvs 284
gi 119622706  516 gcetcssraatqclscrrgfyhhqemntcvtlcpagfyadesqknclkchpsckkcvdepekctvckegfSLARGSCipd 595
gi 154278814 1578 --------------------------------------------------------alfgepgspfymenLIIVGETded 1601
gi 70986580   269 ----------------------------------------------------------fgdpanpnhipeLIVVGSVlgq 290
gi 171681375 1297 --------------------------------------------------------ardvwprgeaqvpnIILVGATdih 1320
gi 119174789  973 -------------------------------------------------------------palfgaepsTLKPELQanw 991
gi 7981346    429 --------------------------------------------------------------yanaavpaRWSLDGSlpd 446
gi 116200834 1273 ------------------------------------------------------------------glraMHSVPWSdht 1286
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1R6V_A        323 ggtfr-----------------------------vagfssrsDGVSVGApgvtilstvpgedsigyeghnenvpatnggt 373
gi 169613975  406 gkawek---------------------------sqgqgsqdgTQLAIYApgvdvvvh-----------------dhidgk 441
gi 124010196  285 nhynhlvags-------------------npeesvatysnfgERLDIVApaggvasgfd-------------rrrsyttt 332
gi 119622706  596 cepgtyfdselircgechhtcgtcvgpgreecihcaknfhfhDWKCVPAcgegfypee--------------mpglphkv 661
gi 154278814 1602 gnqg--------------------------------psglyrTWITTFApgygvwvp-----------------qtptgg 1632
gi 70986580   291 gil---------------------------------gqhanaDWVTCYApgyglrmad--------------sdpesate 323
gi 171681375 1321 gr-----------------------------------rgifsQACEVYAagvdvavsl---------------lgggddd 1350
gi 119174789  992 lhvpellvvgavd-------------vftgerwwksaidvdkGLPHIYApgkhvlgtqgnk---------gewrrdfegt 1049
gi 7981346    447 tlvv-------------------------------gfasnhgYRALGSLpwnidgrldd-------------ssmvfapa 482
gi 116200834 1287 dt-----------------------------------gmvygPGLNLYQnggellhgtslaapmi-ssvvaylraldspf 1330
                         650       660       670       680       690       700       710
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
Feature 1                #                                                                
1R6V_A        374 yDYYQGTSMAAPHVTGVVAVLlqkfpn--------------------------------akpwqIRKLLENT 413
gi 169613975  442 eTRATGTSMAAPAVAGIIAVHmnyqpwgkd-------------------------ntglarvkeIRRWIQTP 488
gi 124010196  333 vWGAGQLSSESPLELTVVAGVsdt-------------------------------------eleLRNLHGVF 367
gi 119622706  662 cRRCDENCLSCAGSSRNCSRCktgftqlgtscitnhtcsnadetfcemvksnrlcerklfiqfcCRTCLLAG 733
gi 154278814 1633 yTVKAGTSLSAPLVSGLIAYYrsiqspwq---------------------------dqlkdpanVKKMIKIF 1677
gi 70986580   324 yRTTQGTSFASATVAGLAAYFrgldst-------------------------------lttaasVKERILRL 364
gi 171681375 1351 fEVVNGTSFAAPVVSGLVAYLralvaikdps-----------------------rlrefddpayVKEFIWSN 1399
gi 119174789 1050 yKVEVGTSVATAYAAGLAAYFlrlhqvgrlgpd-------------------akgndpdmspagLKRYIINN 1102
gi 7981346    483 sRLTVVRYAAAPMVAALVAYLralpspfaed------------------------lkktvfavkMVKYLTRK 530
gi 116200834 1331 aNDLRNPVFAVKMVEYLARKVrviddtgti--------------------------dsdeeqegFHARIIWN 1376

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap