1YAZ,1AZV,1DO5,1EQW,1ESO,1F1G,1JK9,1L3N,1SRD,1SXA,1XSO,1YAI,2APS


Conserved Protein Domain Family
Cu-Zn_Superoxide_Dismutase

?
cd00305: Cu-Zn_Superoxide_Dismutase 
Click on image for an interactive view with Cn3D
Copper/zinc superoxide dismutase (SOD). superoxide dismutases catalyse the conversion of superoxide radicals to molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the human SOD1 gene causes familial amyotrophic lateral sclerosis (Lou Gehrig's disease). Cytoplasmic and periplasmic SODs exist as dimers, whereas chloroplastic and extracellular enzymes exist as tetramers. Structure supports independent functional evolution in prokaryotes (P-class) and eukaryotes (E-class) [PMID:.8176730].
Statistics
?
PSSM-Id: 238186
View PSSM: cd00305
Aligned: 67 rows
Threshold Bit Score: 110.428
Threshold Setting Gi: 22654105
Created: 6-Mar-2002
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                      # #              
1YAZ_A        1 VQAVAVLKGda-------gvSGVVKFEQAses-epTTVSYEIAGNSPn----------AERGFHIHEFGDat-----ngC 57
gi 134604    25 TSATAVVKAgdg------kdAGAVTVTEAph---gVLLKLELKGLTP-----------GWHAAHFHEKGDcgt----pdF 80
gi 12230573  15 FSIAQELKThadivnqkgekIGKAELIQTns---gVLIKLEASNLPPn----------AELAFHIHELGKcdp----pdF 77
gi 15894642  30 RRAVATIVGgpla----pniRGTVTFTSVpn---gTEVSVVLNGLPPyrpamggrpqvGPHGFHIHQNGNctpgtaaqpF 102
gi 21240984   9 TTATAELKPtkg-----ndvKGTVTFKTVdg---aLRVTGQLSGLKPn----------TEHGFHIHEKGDcsa----pdG 66
gi 22654102  70 QSLTSTLTApdg------tkVATAKFEFAngyatvTIATTGVGKLTP-----------GFHGLHIHQVGKcepn-svapT 131
gi 22654104  56 PSITTHLKApdg------tqVATAKFEFSng---yATVTIETTANGVlt--------pGFHGVHIHKVGKceps-svapT 117
gi 22654105  70 PNIITRLNApdg------tqVATAKFEFNng---fATITIATTGVGHla--------pGFHGVHIHKVGKc-------eP 125
gi 23100535  46 EEVLVSLENneg------qvVGTATLTEGee---gVQISLEGENLPA-----------GEHGFHIHEAGKcel----pnF 101
gi 31198865  16 VGATLVADNpeq------qiMGTISFRQWap--ghVQTAINVTGLPV-----------GKHAVHVHAFGDmr-----egC 71
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            #                        #  #                                              
1YAZ_A       58 VSAGPHFNPFKKt------HGaptd--evrHVGDMGNV--KTDe-------nGVAKGSFKDSLIKLIgp-------tSVV 113
gi 134604    81 KSAGAHVHTAATt-----vHGllnp--danDSGDLPNIfaAAD---------GAATAEIYSPLVSLKga-------gGRP 137
gi 12230573  78 KSAKGHFNPFKKk------HGllnp--egpHAGDMPNI--HTDd-------kGNVRVQVLNPFVTLKk--------gKKN 132
gi 15894642 103 PGTGEHWNPTNQp------HGn--------HAGDFPVV--FSNn--------GYARMTFFTNKFRVP----------QVI 148
gi 21240984  67 SSAGGHFNPSQSd------HGnisa--dphHGGDMPNI--TADaq-----gnASIDGPVSSNVNLGKad------qfDIA 125
gi 22654102 132 GGAPGNFLSAGGhyh-vpgHTgt------pASGDLASL--QVRgdgs-amlvTTTDAFTMDDLLSGAktaiiihagaDNF 201
gi 22654104 118 GGAPGDFLSAGGhfq-apgHTge------pASGDLTSL--QVRkdgs-gtlvTTTDAFTMEDLLGGRktaiiihagaNNF 187
gi 22654105 126 SSAGPTGGAPGDfls-aggHFqvpghtvepASGNLTSL--QVRkdgigtlvtTTDAFTMNDLLAGQKtaiii-hagaDNF 201
gi 23100535 102 ESAGSHYNPTNAk------HGfnhp--egpHAGDLENI--TVEe-------dGTVQTEVDAPMVTLQa--------dTEN 156
gi 31198865  72 KSTGPHFRSSIIgnievkeDGn--------AMIDFHSP--YINl-------fGFAGIVGRSIVIHEKp---------SEV 125
                       170       180       190
                ....*....|....*....|....*....|...
Feature 1             #                          
1YAZ_A      114 GRSVVIHAGQDDLGKGDTEESLKTGNAGPRPAC 146
gi 134604   138 ALLDADGSSIVVHANPDDHKTQPIGGAGARVAC 170
gi 12230573 133 SLFKEGGTALVIHGGPDDYKSDPAGNAGKRIAC 165
gi 15894642 149 GKSVVLHESPDDYRTQPAGASGRKVACGVIRAV 181
gi 21240984 126 GHAVIVHADADDYKTQPTGNAGGRLACGVITTD 158
gi 22654102 202 ANIPPERYVQVNGTPGPDETTLTTGDAGKRVAC 234
gi 22654104 188 ANIPAERYNQTNGTPGPDEMTMSTGDAGKRVAC 220
gi 22654105 202 GNIPPERYSQVNGTPGPDATTISTGDAGKRVAC 234
gi 23100535 157 TLYTEQGTSLIIHSGPDDYKSQPSGDAGDRIAC 189
gi 31198865 126 YRFPDLSINNPISFQGEEDTVGARIACGLITIL 158

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap