Conserved Protein Domain Family
Pyruvate_Kinase

?
cd00288: Pyruvate_Kinase 
Click on image for an interactive view with Cn3D
Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low affinity T state. PK exists as several different isozymes, depending on organism and tissue type. In mammals, there are four PK isozymes: R, found in red blood cells, L, found in liver, M1, found in skeletal muscle, and M2, found in kidney, adipose tissue, and lung. PK forms a homotetramer, with each subunit containing three domains. The T state to R state transition of PK is more complex than in most allosteric enzymes, involving a concerted rotation of all 3 domains of each monomer in the homotetramer.
Statistics
?
PSSM-Id: 238178
View PSSM: cd00288
Aligned: 15 rows
Threshold Bit Score: 674.414
Threshold Setting Gi: 13432190
Created: 6-Mar-2002
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Hierarchy
?
 
active sitedomain
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

cd00288 is part of a hierarchy of related CD models.
Use the graphical representation to navigate this hierarchy.
cd00288 is a member of the superfamily cl28161.
cd00288:Pyruvate_Kinase11706981256031PKM  1LIU A1A3W A11706991256074001421PKL G2664281256061PKY D58537113463991343219011706981256031PKM  1LIU A1A3W A11706991256074001421PKL G2664281256061PKY D585371134639913432190
cd00288 Sequence Cluster
cd00288 Sequence Cluster
Sub-family Hierarchy
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                     # #                                     #        
1PKM        41 ARNTGIICTIGPASRSVEILKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFAsdpiryrPVAVALDTKGPEIRT 120
1A3W_A      18 LRRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYHKSVIDNARKSEELYPg-----rPLAIALDTKGPEIRT 92
1PKY_D       1 MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGk------TAAILLDTKGPEIRT 74
gi 125607   32 FRRTSIICTIGPKTNSVEKINALRRAGLNVVRMNFSHGSYEYHQSVIDHAREAEKQAAg-----rPVAIALDTKGPEIRT 106
gi 400142   41 FRRTSIICTIGPKTNSVEALNKLRDAGLNVARMNFSHGSYEYHQSVIDNVRASVAAHPg-----rPVAIALDTKGPEIRT 115
gi 1170699  29 YRKSSIIGTIGPNTNSAEMISKLRQAGLNIVRMNFSHGSYEYHQSVIENARESEQRFRg-----rPLAIALDTKGPEIRT 103
gi 125606   19 IPKTKIVCTLGPSSRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLKIAMQNTQi------LCAVMLDTKGPEIRT 92
gi 585371    2 KRKTKIVCTIGPASESVDKLVQLMEAGMNVARLNFSHGDHEEHGRRIANIREAAKRTGr------TVAILLDTKGPEIRT 75
gi 1170698   5 LRRTKIVCTMGPSTDRDNNLEKIIAAGANVVRMNFSHGTPDDHIGRAERVRSIAKKLGk------TVAILGDLQGPKIRV 78
gi 1346399   1 MKKTKIVSTLGPASDDIETITKLAEAGANVFRFNFSHGNHEEHLARMNMVREVEKKTGk------LLGIALDTKGAEIRT 74
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      
1PKM       121 GLIKGsgtaEVELKKGATLKITLDnaymeKCDENVLWLDYKNICKVVEVGSKVYVDDGLISLLVKEKGAD--FLVTEVEN 198
1A3W_A      93 GTTTNd--vDYPIPPNHEMIFTTDdkyakACDDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVLEVVDDk-TLKVKALN 169
1PKY_D      75 MKLEGg--nDVSLKAGQTFTFTTDks--vIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGN--KVICKVLN 148
gi 125607  107 GNTVGd--kDIPIKAGHEMNISTDeqyatASDDQNMYVDYKNITKVISAGKLIYVDDGILSFEVLEVVDDk-TLRVRCLN 183
gi 400142  116 GNTAGd--vDIPISAGTVMNFTTDekyatACDTQNMYVDYKNITKVIQPGRVIYVDDGVLAFDVLSIKDDq-TVEVRARN 192
gi 1170699 104 GVTKDd--kDWDVKAGHVMLFSTNpkykdQCDDKIMYIDYTNIVKQIDIGKIIFVDDGVLSFKVLEKIDGe-TLKVETLN 180
gi 125606   93 GFLTDg--kPIQLKEGQEITVSTDyt--iKGNEEMISMSYKKLVMDLKPGNTILCADGTITLTVLSCDPPsgTVRCRCEN 168
gi 585371   76 HNMENg---AIELKEGSKLVISMSe---vLGTPEKISVTYPSLIDDVSVGAKILLDDGLISLEVNAVDKQagEIVTTVLN 149
gi 1170698  79 STFKDg---KIFLNVGDKFILDAElp-kgEGTQESVGLDYKTLPQDVVPGDILLLDDGRVQLKVLSTDGA--KVFTEVTV 152
gi 1346399  75 TDQEGg---KFTINTGDEIRVSMDat--kAGNKDMIHVTYPGLFDDTHVGGTVLIDDGAVGLTIKAKDEEkrELVCEAQN 149
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                   #                          # #     
1PKM       199 GGSLGSKKGVNLPGAAVDLPAVSEKDIQDLK-FGVEQdVDMVFASFIRKASDVHEVRKVLGEk-GKNIKIISKIENHEGV 276
1A3W_A     170 AGKICSHKGVNLPGTDVDLPALSEKDKEDLR-FGVKNgVHMVFASFIRTANDVLTIREVLGEq-GKDVKIIVKIENQQGV 247
1PKY_D     149 NGDLGENKGVNLPGVSIALPALAEKDKQDLI-FGCEQgVDFVAASFIRKRSDVIEIREHLKAhgGENIHIISKIENQEGL 227
gi 125607  184 NGNISSRKGVNLPGTDVDLPALSEKDISDLK-FGVKNkVDMVFASFIRRGSDIRHIREVLGEe-GREIQIIAKIENQQGV 261
gi 400142  193 NGFISSRKGVNLPNTDVDLPALSEKDKADLR-FGVKNnVDMVFASFIRRAQDIKDIRDVLGPe-GKQIQIIAKIENRQGL 270
gi 1170699 181 NGKISSRKGVNLPGTDVDLPALSEKDKADLK-FGVEHgVDMIFASFVRTANDVQAIRDVLGEk-GKGIQVISKIENQQGV 258
gi 125606  169 TATLGERKNVNLPGVVVDLPTLTEKDKEDILeWGVPNnIDMIALSFVRKGSDLVNVRKVLGPh-AKRIQLMSKVENQEGV 247
gi 585371  150 GGVLKNKKGVNVPGVKVNLPGITEKDRADIL-FGIRQgIDFIAASFVRRASDVLEIRELLEAhdALHIQIIAKIENEEGV 228
gi 1170698 153 GGPLSNNKGINKLGGGLSADALTEKDKADII-TAARIgVDFLAVSFPRSSADLNYARELAQQa-GLNAKIVAKVERAETV 230
gi 1346399 150 TGVIGSKKGVNAPGVEIRLPGITEKDTDDIR-FGLKHgINFIFASFVRKAQDVLDIRALCEEanASYVKIFPKIESQEGI 228
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                           #                               #                          
1PKM       277 RRFD---EILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLD 353
1A3W_A     248 NNFD---EILKVTDGVMVARGDLGIEIPAPEVLAVQKKLIAKSNLAGKPVICATQMLESMTYNPRPTRAEVSDVGNAILD 324
1PKY_D     228 NNFD---EILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATMMLDSMIKNPRPTRAEAGDVANAILD 304
gi 125607  262 NNFD---EILEETDGVMVARGDLGIEIPAPKVFIAQKMMIAKCNIKGKPVICATQMLESMTYNPRPTRAEVSDVANAVLD 338
gi 400142  271 NNFA---EILEETDGVMVARGDLGIEIPAAEVFAAQKKMIAMCNIAGKPVICATQMLESMIKNPRPTRAEISDVGNAVTD 347
gi 1170699 259 NNFD---EILKETDGVMVARGDLGIEIPAPQVFIAQKQLIAKCNLAGKPVICATQMLDSMTYNPRPTRAEVSDVGNAVLD 335
gi 125606  248 INFD---EILRETDSFMVARGDLGMEIPVEKIFLAQKMMIYKCNLAGKAVVTATQMLESMIKSPAPTRAEATDVANAVLD 324
gi 585371  229 ANID---EILEAADGLMVARGDLGVEIPAEEVPLIQKLLIKKCNMLGKPVITATQMLDSMQRNPRPTRAEASDVANAIFD 305
gi 1170698 231 ANDEamdDIILASDVIMVARGDLGVEIGDPELVGVQKKLIRRSRQLNRAVITATQMMESMISNPMPTRAEVMDVANAVLD 310
gi 1346399 229 DNID---EILQVSDGLMVARGDMGVEIPFINVPFVQKTLIKKCNALGKPVITATQMLDSMQENPRPTRAEVTDVANAVLD 305
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      
1PKM       354 GADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRGsshstdlMEAMAMGSVEASYKC-LAAALIVLTE 432
1A3W_A     325 GADCVMLSGETAKGNYPINAVTTMAETAVIAEQAIAYLPNYDDMRNCtpkptstTETVAASAVAAVFEQ-KAKAIIVLST 403
1PKY_D     305 GTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEFNNDNRKlr----iTEAVCRGAVETAEKL-DAPLIVVATQ 379
gi 125607  339 GADCVMLSGETAKGNYPCEAVTMMSETCLLAEVAIPHFNVFDELRNLaprptdtVESIAMAAVSASLEL-NAGAIVVLTT 417
gi 400142  348 GADCVMLSGETAKGNYPAESIHEMHEASLKAENTIPYVSHFEEMCTLvkrpvstVESCAMAAVRASLDL-GAGGIIVLST 426
gi 1170699 336 GADCVMLSGETAKGTYPIESVKMMHETCLVAEKAIAYAPLFNEMRTLtvrptetVETIAISAVSASFEQ-QARAIIVLST 414
gi 125606  325 GTDCVMLSGESAAGAYPELAVKIMSRICIEAESSLDNEAIFKEMIRCtplpmspLESLASSAVRTANKA-RAKLIVVLTR 403
gi 585371  306 GTDAVMLSGETAAGQYPVEAVKTMHQIALRTEQALEHRDILSQRTKEsqt--tiTDAIGQSVAHTALNL-DVAAIVTPTV 382
gi 1170698 311 GTDAVMLSAETAAGQYPSETVAAMASVCLGAEKMPSINVSRHRMDKEfe---tiEESVAMSAMYAANHMkGVAAIVTLSS 387
gi 1346399 306 GTDATMLSGESANGLYPVQSVQAMHDIDVRTEKELDTRNTLALQRFEeykgsnvTEAIGESVVRTAQEL-GVKTIIAATS 384
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      
1PKM       433 SGRSAHQVARYRPRAPIIAVTRN-------------HQTARQAHLYRGIFPVVCkdpvqe----awaedVDLRVNLAMNv 495
1A3W_A     404 SGTTPRLVSKYRPNCPIILVTRC-------------PRAARFSHLYRGVFPFVFekepvs----dwtddVEARINFGIEk 466
1PKY_D     380 GGKSARAVRKYFPDATILALTTN-------------EKTAHQLVLSKGVVPQLVkeit--------stdDFYRLGKELAl 438
gi 125607  418 SGNTARMISKYRPVCPIIMVSRN-------------PAATRYSHLYRGVWPFYFpekkpdfnvkiwqedVDRRLKWGINh 484
gi 400142  427 SGDSARLLSKYRPVCPIFMVTRN-------------PTTSRFSHLYRGVYPFLYpeqkpdfdtvnwqedVDKRIKWAVTr 493
gi 1170699 415 SGTSARLCSKYRPNCPILMVTRN-------------AQAARFSHLYRGVYPFIYhkarasn-paewqhdVEERLKWGMDe 480
gi 125606  404 GGSTAKLVAKYRPAVPILSVVVPvlttdsfdwsisdETPARHSLVYRGLIPLLGegsaka----tdsesTEVILEAALKs 479
gi 585371  383 SGKTPQMVAKYRPKAPIIAVTSN-------------EAVSRRLALVWGVYTKEAphv----------ntTDEMLDVAVDa 439
gi 1170698 388 TGRTPLLMSRISSGLPIFALSRN-------------QETLNLCALYRGVTPIYHgee----------srTEAGAKAAPQs 444
gi 1346399 385 SGYTARMISKYRPDATIVALTFD-------------EKIQHSLGIVWGVEPVLAkkp----------snTDEMFEEAARv 441
                      490       500       510
               ....*....|....*....|....*....|....*
Feature 1                                         
1PKM       496 gkargfFKHGDVVIVLTGwrp-gsGFTNTMRVVPV 529
1A3W_A     467 akefgiLKKGDTYVSIQGfka-gaGHSNTLQVSTV 500
1PKY_D     439 qs--glAHKGDVVVMVSGalv-psGTTNTASVHVL 470
gi 125607  485 glklgiINKGDNIVCVQGwrg-gmGHTNTVRVVPA 518
gi 400142  494 aielktLTAGDTVVVVQGwkg-gmGNTNTLRIVRA 527
gi 1170699 481 avalgiLNKGDVVVAIQGwtg-glATPTLSEFSSV 514
gi 125606  480 avtrglCKPGDAVVALHRi-----GSASVIKICVV 509
gi 585371  440 avrsglVKHGDLVVITAGvpvgetGSTNLMKVHVI 474
gi 1170698 445 lkekgyLSTGDLVLVTQGgq--gaTQTNVCRTLIV 477
gi 1346399 442 akehgfVKDGDLVIIVAGvpfgqsGTTNLMKLQII 476

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap