Conserved Protein Domain Family
Cytochrome_b_N

?
cd00284: Cytochrome_b_N 
Click on image for an interactive view with Cn3D
Cytochrome b (N-terminus)/b6/petB: Cytochrome b is a subunit of cytochrome bc1, an 11-subunit mitochondrial respiratory enzyme. Cytochrome b spans the mitochondrial membrane with 8 transmembrane helices (A-H) in eukaryotes. In plants and cyanobacteria, cytochrome b6 is analogous to eukaryote cytochrome b, containing two chains: helices A-D are encoded by the petB gene and helices E-H are encoded by the petD gene in these organisms. Cytochrome b/b6 contains two bound hemes and two ubiquinol/ubiquinone binding sites. The C-terminal portion of cytochrome b is described in a separate CD.
Statistics
?
PSSM-Id: 238176
View PSSM: cd00284
Aligned: 11 rows
Threshold Bit Score: 154.834
Threshold Setting Gi: 117895
Created: 6-Mar-2002
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 22 residues -Click on image for an interactive view with Cn3D
Feature 1:heme bL binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                       #  ##  ## ##  #          #             #  ##  # 
1BCC_C       10 PLLKMINNSLIDlPAPSnisawWNFGSLLAVCLMTQILTGLLLAMHYTadTSLAFSSVAHTCRNVQYGWLIRNLHANGAS 89
1BGY_C        9 PLMKIVNNAFIDlPAPSnisswWNFGSLLGICLILQILTGLFLAMHYTsdTTTAFSSVTHICRDVNYGWIIRYMHANGAS 88
3BCC_C       10 PLLKMINNSLIDlPAPSnisawWNFGSLLAVCLMTQILTGLLLAMHYTadTSLAFSSVAHTCRNVQYGWLIRNLHANGAS 89
gi 461886    11 PIFSTFNNHLIDyPTPSnisywWGFGSLAGLCLVIQILTGVFLAMHYTphVDLAFLSVEHIMRDVKGGWLLRYMHANGAS 90
gi 15604141  21 LPIFSFLKHFSYyQTPKnlnylWNLGSIAGIALVIQIITGVILAMHYTphVDHAFESVERIMRNVNYGWLLRYTHAVGAS 100
1EZV_C        8 VYLSLVNSYIIDsPQPSsinywWNMGSLLGLCLVIQIVTGIFMAMHYSsnIELAFSSVEHIMRDVHNGYILRYLHANGAS 87
gi 2493959   21 VQAISDDIASKYvPPHVni--fYCLGGLTLTCFLIQFATGFAMTFYYKptVTEAFASVQYIMNEVNFGWLIRSIHRWSAS 98
gi 117820    14 IQAIADDITSKYvPPHVni--fYCLGGITLTCFLVQVATGFAMTFYYRptVTDAFASVQYIMTEVNFGWLIRSVHRWSAS 91
gi 399321    14 IQAIADDVSSKYvPPHVni--fYCLGGITFTCFIIQVATGFAMTFYYRptVTEAFLSVKYIMNEVNFGWLIRSIHRWSAS 91
gi 1345901    1 MKLDFVNSMVVSlPSSKvltygWNFGSMLGMVLGFQILTGTFLAFYYSndGALAFLSVQYIMYEVNFGWIFRVLHFNGAS 80
gi 117895     3 YKSGEKRKGLLMsGCLYr---iYGVGFSLGFFIALQIICGVCLAWLFFscFICSNWYFVLFLWDFDLGFVIRSVHICFTS 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                              ##  ## ##                                
1BCC_C       90 FFFICIFLHIGRGLYYGSY--LYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEWAWG 167
1BGY_C       89 MFFICLYMHVGRGLYYGSY--TFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWG 166
3BCC_C       90 FFFICIFLHIGRGLYYGSY--LYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEWAWG 167
gi 461886    91 MFFIVVYLHFFRGLYYGSYasPRELVWCLGVVILLLMIVTAFIGYVLPWGQMSFWGATVITSLASAIPVVGDTIVTWLWG 170
gi 15604141 101 MFFAAIYLHIARGLYYGSYktPRELLWHIGIIIFLIMMATAFMGYVLPWGQMSYWGATVITNLFSAIPLVGEPIVIWLWG 180
1EZV_C       88 FFFMVMFMHMAKGLYYGSYrsPRVTLWNVGVIIFTLTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWG 167
gi 2493959   99 MMVLMMILHVFRVYLTGGFkkPRELTWVVGVMLAVTTVTFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDQLVTLMRG 178
gi 117820    92 MMVLMMILHVFRVYLTGGFkkPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRG 171
gi 399321    92 MMVLMMILHVCRVYLTGGFkkPRELTWVTGIILAILTVSFGVTGYSLPWDQVGYWAVKIVTGVPEAIPLIGNFIVELLRG 171
gi 1345901   81 LFFIFLYLHLFKGLFFMSY--RLKKVWVSGIVILLLVMMEAFMGYVLVWAQMSFWASVVITSLLSVIPVWGFAIVTWIWS 158
gi 117895    80 LLYLLLYIHIFKSITLIILfdTHILVWFIGFILFVFIIIIAFIGYVLPCTMMSYWGLTVFSNIIATVPILGIWLCYWIWG 159
                       170       180       190       200
                ....*....|....*....|....*....|....*....|.
Feature 1                      # #  #                    
1BCC_C      168 GFSVDNPTLTRFFALH-FLLPFAIAGITIIHLTFLHESGSN 207
1BGY_C      167 GFSVDKATLTRFFAFH-FILPFIIMAIAMVHLLFLHETGSN 206
3BCC_C      168 GFSVDNPTLTRFFALH-FLLPFAIAGITIIHLTFLHESGSN 207
gi 461886   171 GFSVDNATLNRFFSLH-YLLPFIIAGASILHLAALHQYGSN 210
gi 15604141 181 GFSVDNPTLNRFFALH-YLFPFIIVVLVILHLVALHQHGSN 220
1EZV_C      168 GFSVSNPTIQRFFALH-YLVPFIIAAMVIMHLMALHIHGSS 207
gi 2493959  179 SESVGQATLTRFYSLHtFVLPWAIAVLLLLHFLMIRKQGIS 219
gi 117820   172 SASVGQSTLTRFYSLHtFVLPLLTAVFMLMHFLMIRKQGIS 212
gi 399321   172 SVSVGQSTLTRFYSLHtFVLPLLTATFMLGHFLMIRKQGIS 212
gi 1345901  159 GFTVSSATLKFFFVLH-FLVPWGLLLLVLLHLVFLHETGST 198
gi 117895   160 SEFINDFTLLKLHVLH-VLLPFILLIILILHLFCLHYFMSS 199

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap