1KFU


Conserved Protein Domain Family
Calpain_III

?
cd00214: Calpain_III 
Click on image for an interactive view with Cn3D
Calpain, subdomain III. Calpains are calcium-activated cytoplasmic cysteine proteinases, participate in cytoskeletal remodeling processes, cell differentiation, apoptosis and signal transduction. Catalytic domain and the two calmodulin-like domains are separated by C2-like domain III. Domain III plays an important role in calcium-induced activation of calpain involving electrostatic interactions with subdomain II. Proposed to mediate calpain's interaction with phospholipids and translocation to cytoplasmic/nuclear membranes. CD includes subdomain III of typical and atypical calpains.
Links
?
Statistics
?
PSSM-Id: 238132
View PSSM: cd00214
Aligned: 25 rows
Threshold Bit Score: 131.267
Threshold Setting Gi: 7656959
Created: 24-May-2001
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
acidic loop
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:acidic loop
Evidence:
  • Comment:residues of acidic loop form several salt bridges involved in Ca2+-dependent calpain activation
  • Comment:not found in all members
  • Structure:1KFU_L; subdomain II-III salt bridges important in Ca2+-induced activation of calpain.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                      ###          #                    
1KFU_L       353 KKWKLTKMDGNWRRg--------STAGGCrNYPNTFWMNPQYLIKLEEEdedeedgesgCTFLVGLIQKhrrrqr----- 419
gi 7293208   708 LHWKMKMHQGQWKRg--------VTAGGC-RNHESFHINPQLLISVQDE----------QDLVIALNQHtav-------- 760
gi 17510079  468 QQWIQASFEGEWSSr-------iGTAGGC-DDHDTFCTNLQYEIHFRATdsyd--snhkCTIIAALFQKnrdhcv----- 532
gi 17544252  473 KQWIQKSADGEWCSr-------kGTAGGCsNNENTFCTNPQYETYFRATspss---ndkCTVIAAVFQKyrrnql----- 537
gi 13959310  349 GRKELESVVGCWTVddd---plmNRSGGCyNNRDTFLQNPQYIFTVPEDg---------HKVIMSLQQKdlrtyrr---- 412
gi 2065242   352 KTWEEARLHGAWTRhed---pqqNRSGGCiNHKDTFFQNPQYVFEVKKPe---------DEVLISIQQRpkrstrr---- 415
gi 17542636  362 RSYDEQIVFSEWTTngkksgapdDRAGGChNFKATFCNNPQYIFDIPSPn---------CSVMFALIQNdpsegl----- 427
gi 15222697 1997 VPQMRYSVNGQWRG---------YSAGGC-QDYSSWHQNPQFRLRATGSda-------sLPIHGVGFSRttpgfrny--- 2056
gi 21263445  335 LLCHTRALPGAWVKg--------QSAGGC-RNNSGFPSNPKFWLRVSEP----------SEVYIAVLQRsrlhaadwagr 395
gi 13186306  335 LLCHTRALPGAWVKg--------QSAGGC-RNNSGFPSNPKFWLRVSKP----------SEVYIAVLQRsrlhaadwagr 395
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1KFU_L       420 ----------------kmgedmHTIGFGIYEVpeelsgqtniHLSKNFFLtnrarersdTFINLREVLNRFK-LPPG--E 480
gi 7293208   761 --------------------epKVIGFTMYTWdgey--mlseCLQKDFFKnhvs-ylnsDYGNTRHVSYHTH-LEAG--H 814
gi 17510079  533 ----------------ykglelFLIGLLVYEMpgp-----neKVTPEMVKsqtpiadskLFKDSREANIRFT-VPLG--H 588
gi 17544252  538 ----------------hrgldmLQIGLSVYKMsgp-----neKVTAEMMKthapiastkLFVDYREAVVRFT-VPPG--Y 593
gi 13959310  413 ----------------mgrpdnYIIGFELFKVem------nrRFRLHHLYiqer-agtsTYIDTRTVFLSKY-LKKG--S 466
gi 2065242   416 ----------------egkgenLAIGFDIYKVee------nrQYRMHSLQhka---assIYINSRSVFLRTE-LPEG--R 467
gi 17542636  428 ----------------kkrepfVTIGMHVMKVen------nrQYRVHTAMhpi---aisDYASGRSVYLHLQsLPRG--R 480
gi 15222697 2057 --------------qsshdsqlFYIGLRILKTrg-------rRAAYNIFLhesv--ggtDYVNSREISCEMV-LDPDpkG 2112
gi 21263445  396 aralvgdshtswspasipgkhyQAVGLHLWKVekr-----rvNLPRVLSMppva--gtaCHAYDREVHLRCE-LSPG--Y 465
gi 13186306  396 aralvgdshtswspasipgkhyQAVGLHLWKVpeg-----grSQDAPPLLlqepllscvPHRYAQEVSRLCL-LPAG--T 467
                        170       180       190
                 ....*....|....*....|....*....|.
Feature 1                                       
1KFU_L       481 YILVPSTFEPNKDGDFCIRVFSEKKADYQAV 511
gi 7293208   815 YVLIPTTYEPAEEAHFTVRILGTGSFRLSCL 845
gi 17510079  589 YVIVPSTYDPDQDGEFLLRIFTNVDFDKTHA 619
gi 17544252  594 YVIVPCTFEPNHDAEFLLRTFSNVEFDKTDM 624
gi 13959310  467 YVLVPTMFQHGRTSEFLLRIFSEVPVQLREL 497
gi 2065242   468 YVIIPTTFEPGHTGEFLLRVFTDVPSNCREL 498
gi 17542636  481 YLLIPTTFAPKEQTLFMLRVYSDEHIHFSPL 511
gi 15222697 2113 YTIVPTTIHPGEEAPFVLSVFTKASIVLEAL 2143
gi 21263445  466 YLAVPSTFLKDAPGEFLLRVFSTGRVSLSAI 496
gi 13186306  468 YKVVPSTYLPDTEGAFTVTIATRIDRPSIHS 498

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap