1D9X,1QDE,1WP9,2EYQ,2IPC,2V1X,2V6I,2VSF,2ZJ2,3DMQ,3LLM,3OIY,4BE7,4NL4,4QQX,5B7I,5GQH,5V9X


Conserved Protein Domain Family
SF2-N

?
cd00046: SF2-N 
Click on image for an interactive view with Cn3D
N-terminal DEAD/H-box helicase domain of superfamily 2 helicases
The DEAD/H-like superfamily 2 helicases comprise a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This N-terminal domain contains the ATP-binding region.
Statistics
?
PSSM-Id: 350668
Aligned: 22 rows
Threshold Bit Score: 66.2729
Created: 1-Nov-2000
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
 
ATP bindingDEAD box
Conserved site includes 11 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              ########                                    #                           
1D9X_A      32 VKHQTLLGATGTGKTFTISNVIAqvn--------kpTLVIAHnkTLAGQLYSELKEffp---hnAVEYFVSYydyyqpea 100  Bacillus caldotenax
2EYQ_A     624 AMDRLVCGDVGFGKTEVAMRAAFlavd-----nhkqVAVLVPttLLAQQHYDNFRDrfan-wpvRIEMISRFrsakeqtq 697  Escherichia coli
2V1X_A      59 GKEVFLVMPTGGGKSLCYQLPALcsd--------gfTLVICPliSLMEDQLMVLKQlg-----iSATMLNASsskehvkw 125  human
3DMQ_A     170 APRVLLADEVGLGKTIEAGXILHqqlls---gaaerVLIIVPe-TLQHQWLVEXLRrf----nlRFALFDDEryaeaqhd 241  Escherichia coli...
3LLM_A      76 NSVVIIRGATGCGKTTQVPQFILddfiqndraaecnIVVTQPrrISAVSVAERVAFergeepgkSCGYSVRFesilp--- 152  human
3OIY_A      36 GKSFTMVAPTGVGKTTFGMMTALwlar-----kgkkSALVFPtvTLVKQTLERLQKlad--ekvKIFGFYSSmkkeekek 108  Thermotoga maritima
4NL4_H     232 FSAWLLAGITGSGKTEVYLSVLEnvla-----qgrqALVMVPeiGLTPQTIARFRQrf----naPVEVLHSGlndserls 302  Klebsiella pneum...
5B7I_A     419 GFFGLNLASTGCGKTLANGRILYaladp---qrgarFSIALGlrSLTLQTGQAYRErlgl-gddDLAILVGGsaarelfe 494  Pseudomonas aeru...
5GQH_A     427 GFFGLNLASTGCGKTLANGRILYaladp---qrgarFSIALGlrSLTLQTGQAYRErlgl-gddDLAILVGGsaarelfe 502  Pseudomonas aeru...
729157     139 KEELLIWAVCGAGKTEMLFPGIEsaln-----qglrVCIATPrtDVVLELAPRLKAafq---gaDISALYGGsddk---- 206  Bacillus subtilis
Feature 1                                                                                      
1D9X_A     101 yvpqtdtyiekdak----------------indeidklrhsatsalferrdVIIVASVsciyglgspeeyrelvvslrvg 164  Bacillus caldotenax
2EYQ_A     698 i-----------------------------------------laevaegkiDILIGTHkllqsdv--------------- 721  Escherichia coli
2V1X_A     126 vh---------------------------------------aemvnknselKLIYVTPekiakskmfmsr---------- 156  human
3DMQ_A     242 -------------------------------------------aynpfdteQLVICSLdfarrskqrl------------ 266  Escherichia coli...
3LLM_A     153 -----------------------------------------------rphaSIXFCTVgvllrkle-------------- 171  human
3OIY_A     109 f-----------------------------------------eksfeeddyHILVFSTqfvsknre-------------- 133  Thermotoga maritima
4NL4_H     303 a-----------------------------------------wlkakngeaAIVIGTRsslftp---------------- 325  Klebsiella pneum...
5B7I_A     495 kqqerlersgsesaqellaenshvhfagtledgplrewlggnsagnrllqaPILACTIdhlxpaseslrgg--------- 565  Pseudomonas aeru...
5GQH_A     503 kqqerlersgsesaqellaenshvhfagtledgplrewlgrnsagnrllqaPILACTIdhlmpaseslrgg--------- 573  Pseudomonas aeru...
729157     207 -----------------------------------------------grlsPLMISTThqllry---------------- 223  Bacillus subtilis
Feature 1                                                                                      
1D9X_A     165 meiernallrrlvdiqydrndidfrgtfrvrgdvveifpasrdehcirveffgdeieriraevdaltgkvlgerehvaif 244  Bacillus caldotenax
2EYQ_A         --------------------------------------------------------------------------------      Escherichia coli
2V1X_A         --------------------------------------------------------------------------------      human
3DMQ_A         --------------------------------------------------------------------------------      Escherichia coli...
3LLM_A         --------------------------------------------------------------------------------      human
3OIY_A         --------------------------------------------------------------------------------      Thermotoga maritima
4NL4_H         --------------------------------------------------------------------------------      Klebsiella pneum...
5B7I_A         --------------------------------------------------------------------------------      Pseudomonas aeru...
5GQH_A         --------------------------------------------------------------------------------      Pseudomonas aeru...
729157         --------------------------------------------------------------------------------      Bacillus subtilis
Feature 1                                                                                      
1D9X_A     245 pashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmremgfcsgienysrhlalrppgstpyt 324  Bacillus caldotenax
2EYQ_A         --------------------------------------------------------------------------------      Escherichia coli
2V1X_A     157 ------------------------------------------------------------------------------le 158  human
3DMQ_A         --------------------------------------------------------------------------------      Escherichia coli...
3LLM_A         --------------------------------------------------------------------------------      human
3OIY_A         --------------------------------------------------------------------------------      Thermotoga maritima
4NL4_H         --------------------------------------------------------------------------------      Klebsiella pneum...
5B7I_A     566 -----------------------------------------------------------------------------hqi 568  Pseudomonas aeru...
5GQH_A     574 -----------------------------------------------------------------------------hqi 576  Pseudomonas aeru...
729157         --------------------------------------------------------------------------------      Bacillus subtilis
Feature 1                   ##                                                        
1D9X_A     325 lldyfpddfLIIVDESHVtlpqlrgmyngdrarkqvlvdhgfrlpsaldnrpltfeefeqkiNQIIYVSAT 395  Bacillus caldotenax
2EYQ_A     722 ---kfkdlgLLIVDEEHRfgvrhker-----------------------------ikamranVDILTLTAT 760  Escherichia coli
2V1X_A     159 kayearrftRIAVDEVHCcsqwghdfrpdy--------------------kalgilkrqfpnASLIGLTAT 209  human
3DMQ_A     267 ehlceaewdLLVVDEAHHlvwsedapsre----------------------yqaieqlaehvPGVLLLTAT 315  Escherichia coli K12
3LLM_A     172 --agirgisHVIVDEIHErdintdfllvv-----------------------lrdvvqaypeVRIVLXSAT 217  human
3OIY_A     134 -klsqkrfdFVFVDDVDAvlkasrnidtllmmvgipeeii-rkafstikqgkiyerpknlkpGILVVSSAT 202  Thermotoga maritima
4NL4_H     326 ----fkdlgVIVIDEEHDssykqqegwryha-------------------rdlavwrahseqIPIILGSAT 373  Klebsiella pneumoniae sub...
5B7I_A     569 apllrlxtsDLVLDEVDDfdiddlpals------------------------rlvhwaglfgSRVLLSSAT 615  Pseudomonas aeruginosa UC...
5GQH_A     577 apllrlmtsDLVLDEVDDfdiddlpals------------------------rlvhwaglfgSRVLLSSAT 623  Pseudomonas aeruginosa UC...
729157     224 ----kdaidVMIIDEVDAfpysadqtlq------------------------favqkarkknSTLVYLSAT 266  Bacillus subtilis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap