Conserved Protein Domain Family
CcmD_alt_fam

?
TIGR04391: CcmD_alt_fam 
CcmD family protein
Members of this protein family are small (typically less than 50 amino acids in length), with the first half highly hydrophobic like transmembrane alpha helices and containing a nearly invariant tyrosine residue. Members from the Desulfovibrionales appear in the position of ccmD of system I c-type cytochrome biogenesis operons (see pfam04995). This family and pfam04995 appear very similar in sequence properties, but the very low level of actual sequence identify makes it unclear that the similarity reflects homology per se.
Statistics
?
PSSM-Id: 275184
Aligned: 29 rows
Threshold Bit Score: 31.6557
Created: 9-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ZP_08045808   3 PLLIAGYGAIFLLIFGYVLRLQRRLVSLEKRLSDRR 38  Haladaptatus paucihalophilus DX253
WP_015774672  2 NYLFIANACIWLGVGGYVLFLARQHSVLERRVRQLE 37  Desulfomicrobium baculatum
WP_013515380  5 TYLFLANCAVWLGVTGYLVFLSLRAGELEKRMHQLE 40  Desulfovibrio aespoeensis
WP_014261164  5 EYVLTANCVVWVFIGMYVFWMSRKAAEIDRRISQLE 40  Desulfovibrio africanus
WP_015851424  5 TYLLIANVAVWVVIAGYLAFIAAKGASMDRRIRQME 40  Desulfovibrio salexigens
WP_014323935  5 VYIFIANVAVWLGVAGYLAFLASRSAGLEKRIRQLE 40  Desulfovibrio desulfuricans
WP_013217910  5 EYLFAVFAVIWILVFFYIALMIRRQQRIKKEIEILE 40  Dehalogenimonas lykanthroporepellens
WP_013076595  5 QYLFLGTAVVWIGTLLYVVSLIRRQNHTLRMIEQLQ 40  Kyrpidia tusciae
WP_013451800  5 EFLFAAYAVIWILLGGYFFRLNNKLNQISHRLDQLE 40  Calditerrivibrio nitroreducens
WP_013887224  5 WFLFSAYMVIWVAIFGYILKLNGKMKELKLKLDKLE 40  Flexistipes sinusarabici
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap