Conserved Protein Domain Family
PseB

?
TIGR03589: PseB 
UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
This enzyme catalyzes the first step in the biosynthesis of pseudaminic acid, the conversion of UDP-N-acetylglucosamine to UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences are members of the broader pfam01073 (3-beta hydroxysteroid dehydrogenase/isomerase family) family.
Statistics
?
PSSM-Id: 132628
View PSSM: TIGR03589
Aligned: 9 rows
Threshold Bit Score: 610.169
Threshold Setting Gi: 33862368
Created: 9-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002858028   1 MFNKKNILITGGTGSFGKTYTKVLLENY-KPNKIIIYSRDELKQFEMASVF-NA------PCMRYFIGDVRDKERLSAAM 72  Campylobacter j...
WP_011333032   1 MFNGKSIFISGGTGSFGRKFIARLLEQY-QPKRVVVFSRDELKQYEMQQTF-NA------PCMRYFLGDVRDADRLRQAM 72  Pseudomonas flu...
WP_011575826   1 MFNNKSILITGGTGSFGKRFVSFILKNY-QPQKLIIYSRDELKQFEMQQVF-DA------PCMRYFIGDVRDKERMISAM 72  Pseudoalteromon...
WP_011714029  14 DLNGQSILVTGGTGSFGRHFIKHVLQHF-KPKRLIIYSRDELKQYEMQTDP-AFmg---hKCLRFFIGDVRDRARLESAL 88  Magnetococcus m...
WP_011279939   1 MLSNSTILITGGTGSFGNTFVPMVLEKY-NPKKVIIFSRDEMKQWDMAKKFvGD------DRVRFFIGDVRDKERLYRAL 73  Psychrobacter a...
WP_011099907   1 MLNNKSILITGGTGSFGKRFTEKILEKY-DVKKIIIYSRDEFKQDLMKKEF-ALkypekiDKLRFFIGDVRDKDRLYRAF 78  Clostridium tetani
WP_011450028   3 FFDNKTILITGGTGSFGNAFTSRLLNNH-NPHSIRIYSRGEYLQWKMQQKF-SD------SRIRFFIGDIRDKARLTRAL 74  Methanospirillu...
WP_011219366   1 MLNNKTVLITGGTGSFGKQFIKTILERYtDVKKIIIYSRDELKQSIIKQQY-PSyd---yPQLRFFIGDVRDKERLTQAC 76  Photobacterium ...
WP_011129474   3 FNSSTSIFITGATGSFGKAFISQLLTQNpHIHRAVVFSRDELKQWEFQQLY-PQkq---yPQLRFFLGDIRDQTRLRRAL 78  Prochlorococcus...
WP_002858028  73 RDVDFVIHAAAMKHVPIAEYNPMECIKTNIHGAQNVIDACFENGVKKCIALSTDKACNPVNLYGATKLASDKLFVAANNI 152 Campylobacter j...
WP_011333032  73 RGIDYVVHAAALKQVPAAEYNPTECIRTNVNGAENIIAAAIDNGVKKVVALSTDKAASPINLYGATKLLSDKLFVAANNI 152 Pseudomonas flu...
WP_011575826  73 RDVDLVVHAAALKQVPAAEYNPNECIKTNINGAQNVIDAAIAANVSRVIALSTDKAANPVNLYGATKLASDKLFVAANNI 152 Pseudoalteromon...
WP_011714029  89 REVDYVIHAAALKQVPTAEYNPMECIHTNVMGAENVVQASLANGIKRVIALSTDKAANPINLYGASKLASDKIFVAANHL 168 Magnetococcus m...
WP_011279939  74 DGVDYVVHAAATKIVPTAEYNPFECVKTNINGAMNLIDACIDKGVKGVVALSTDKASSPINLYGATKLASDKLFVAGNSY 153 Psychrobacter a...
WP_011099907  79 NGVDYIVHAAAMKQVPACEYNPFEAIKTNIHGAQNIIDAALDRGIKKVVALSTDKAVNPINLYGGTKLVSDKLFIAANAY 158 Clostridium tetani
WP_011450028  75 NDVDIVVHAAALKQVPACEYNPIEAVRTNIDGTTNLIDTSIDNNVDRLIALSTDKAVHPVNLYGATKMVAEKLFIQGNAY 154 Methanospirillu...
WP_011219366  77 EGVDVIIHAAAIKQVDTAEYNPTECIRTNIDGAENVIHAALACGVKDVVALSTDKACAPINLYGATKLASDKLFAAANNI 156 Photobacterium ...
WP_011129474  79 EGIDTVVHAAALKQVPAAEYNPFEFIRTNVIGAQNLIEACLDSDVERVVALSTDKAAAPVNLYGATKLCSDKLFIAANNF 158 Prochlorococcus...
WP_002858028 153 AGNKQTRFGVTRYGNVVGSRGSVVPFFKKLISEGAKELPITDTRMTRFWISLEDGVKFVLSNFERMHGGEIFIPKIPSMK 232 Campylobacter j...
WP_011333032 153 AGEQQTRFAVVRYGNVAGSRGSVVPFFSQLIADGATELPITDERMTRFWITLDHGVQFVLDSFARMHGGEVFVPKIPSIR 232 Pseudomonas flu...
WP_011575826 153 SGAKGPRFSVVRYGNVVGSRGSVVPFYRSLMEQGKSNLPVTHAEMTRFWITLDEGVEFVVKNFQRMQGGEIFVPKIPSVA 232 Pseudoalteromon...
WP_011714029 169 SGSIGTRFSVVRYGNVVGSRGSVVPLFQRLVAEGVTELPITDIRMTRFWITLEQGVNFVLSSLAIMRGGEVFIPKIPSMR 248 Magnetococcus m...
WP_011279939 154 SGEHGTKFSVVRYGNVMGSRGSVIPFFMSIKDKGV--LPITDDRMTRFMISLEDGVKLVWHAFEDMVGGEIYVKKIPSMK 231 Psychrobacter a...
WP_011099907 159 SGFDGTIFSVVRYGNVAGSRGSVIPFFKSLIENGCKELPITDFRMTRFWITLEQGVELVFKALEESRGGETYISKIPSFK 238 Clostridium tetani
WP_011450028 155 SGKKTTRFSCVRYGNVVGSRGSIVPLFKMQKEEGK--ITITDPRMTRFWLTLDQGAAFVENCTQIMNGGEIFVPKIPSMK 232 Methanospirillu...
WP_011219366 157 RGSKDIRFSVVRYGNVMGSRGSVIPFFLSKKENGV--LPITHPEMTRFNISLQDGVNLVMFALGNHLGGEIFIPKIPSYK 234 Photobacterium ...
WP_011129474 159 VGSRKLRFSVVRYGNVMGSRGSVIPFFLEQAPSGV--LPITDSRMTRFNISLQEGVNMVMWSLENCLGGELLVPRIPSYR 236 Prochlorococcus...
WP_002858028 233 ITDLAHALAPNLSHKIIGIRAGEKLHEIMISSDDSHLTYEFENYYAISPSIK-FVDKD----NdfsiNALGEKGQKVKDG 307 Campylobacter j...
WP_011333032 233 VVDLARGMAEHLPHKNVGIRPGEKLHELMVPLDDARMTLEFADHYTIQPSIR-FTSVD----VdfaeDKLGERGVPVGED 307 Pseudomonas flu...
WP_011575826 233 ILDLVESMSGTREHELVGIRPGEKLHEVMVPEEMAHHSLEFDDHYVITPAIV-FFEKNidykR----NKLGETGKAVEDK 307 Pseudoalteromon...
WP_011714029 249 VVDLATALAPNTPHKVVGIRPGEKLHEVMITEDDARNTVDLDDRYVIEPTVV-EWSRR----S----FLL-DDGKPVDEA 318 Magnetococcus m...
WP_011279939 232 MTDLARVVAPEAKQEVIGIRPGEKLHEQMISVEDAYYTYEYPEHFKILPTIN-KWAND----P-----ARIKDGKRVPEG 301 Psychrobacter a...
WP_011099907 239 ITDLAKVMLSDCKLKEVGIREGEKLHEVMITKDDSRYTYEYPKHYIVYPHFD-WWNSG----K----YFTP-GGKLIKEG 308 Clostridium tetani
WP_011450028 233 ITDLAEAIAPGIPHEYIGIRPGEKIHEVLITEDEARHTRDLKEYYIIDPEIS-FWNGH----R-------KDYSYTLPEG 300 Methanospirillu...
WP_011219366 235 ILDVATAVAPECTTRDVGIRPGEKLHEEMITDTDSLNTIDLGPYYAILPSVSyTYTEA----D----YMNHHKAEKVPFG 306 Photobacterium ...
WP_011129474 237 IVDVAKAIGPSCTTPITGIRPGEKIHEEMITSSDSFTTVDLGNYFAILPNSG-LCAPD----S----YCERTGAKRVVEG 307 Prochlorococcus...
WP_002858028 308 FSYSSDNNPLWASEKELLEII 328 Campylobacter jejuni
WP_011333032 308 FEYRSDTNPHFLSVGQIADLH 328 Pseudomonas fluorescens
WP_011575826 308 FEYHSGTNPHFLSVEELRTLD 328 Pseudoalteromonas atlantica
WP_011714029 319 FSYTSDSNTEWLDRENLFTML 339 Magnetococcus marinus
WP_011279939 302 FEYASDNNPEWMSDTDLQEWI 322 Psychrobacter arcticus
WP_011099907 309 FEYDSGTNSEWLGVEELKKEL 329 Clostridium tetani
WP_011450028 301 FRYSSETNTEWLDEEGLKQML 321 Methanospirillum hungatei
WP_011219366 307 FKYNSGTNTEWETVEGIRELI 327 Photobacterium profundum
WP_011129474 308 FAYDSGTNTEFLTVEQIRELI 328 Prochlorococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap