Conserved Protein Domain Family
FliI_clade2

?
TIGR03497: FliI_clade2 
flagellar protein export ATPase FliI
Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 274608
View PSSM: TIGR03497
Aligned: 14 rows
Threshold Bit Score: 701.755
Threshold Setting Gi: 489398323
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011065958  19 GKVIRVVGLMIESEGP-TANIGEVCNIKTsaNT--DHALLAEVVGFRNEKIILMPYTEVTEVGPGCLVEATGKPLTVKVG 95  Oceanobacillus ...
WP_010898608  20 GKVTRVIGLTIEAKGP-QASIGELCYILVg-KQ--GTKVMAEVVGFKEERVLLMPLNGTAEIAPGSLVEGTGRPLQVKVG 95  Bacillus halodu...
WP_011392295  24 GKVTRVTGLTIEARGL-KAAIGELCRIYN--NG--SGPIVAEVVGFREEVTLLMPLGELEGIGPGCRVIATGRGHYIRVG 98  Moorella thermo...
WP_005816227  21 GRVAKIVGLMIESDGP-RVSVGEYCRIHT--QQ--GKEIPAEVVGFRNSTTLLMPLAELEGIAPGDRVVPQQHKLEVGVG 95  Desulfitobacter...
WP_012544306  23 GKVLNVSGLSIEALTP-ASFVGELCSVNR--FD--GKPMFAEVVGFKEGKTLLMPIGDVQGIGPNSLIRAMGRPLWIKVS 97  Coprothermobact...
CAA39523      23 GKVKRVIGLMIESKGP-ASSIGDLCLIYA--KGqsGKVIKAEVVGFQEENILLMPYLEAASIAPGSIVEATGESLRVKVG 99  Bacillus subtil...
WP_011416887  34 GRVSEIVGLVVEGQGP-AASIGEMCSLLP--HD--SKPVFAEVVGFKKGKVILMPLEEVQGLGPGCPIKSLGKKAAVKVG 108 Syntrophus acid...
WP_011343919  23 GVVRQVIGLTVEAHGL-KVSVGETVEILA---G--NARVLAEVVGFKEENAILMPLGEINGISLGSLVRPLRRQLQITVG 96  Carboxydothermu...
WP_011175946  40 GRITEIVGMLIKAVVP-QVKIGEVCLIK---RA--GDPLRAEVVGFTKDEVLLSPLGEMTGIGPSSEVIPTHLPLHIKVG 113 Candidatus Prot...
WP_000570584  30 GKVIRVSGNVIYSEGPpDSKIGELMDVQK--SGk-EGYLQCEIVGFEGHVYTLMPLGPIEGIYPEAFVFSSGRKLAIPVG 106 Leptospira inte...
WP_011065958  96 RGLVGKVLNSLGKPLNDt-EELPKGLANFMTEQTPPNPLERPPIRTPLQVGVKAIDSLLTMGEGQRVGLFAGSGVGKSTL 174 Oceanobacillus ...
WP_010898608  96 YSLIGHVIDGCGRPLTG--EALPNGLTPYPTDNPPPNPISRPRIKEAMHLGVRAIDGLLTVGKGQRVGIFAGSGVGKSTL 173 Bacillus halodu...
WP_011392295  99 EELLGRVLDGLGRSLDG--TVLVSG-DPQPVNNRPPNPLSRRRIKEVLATGVKAIDALLTCGCGQRVGIFAGSGVGKSTL 175 Moorella thermo...
WP_005816227  96 QALLGRILDGLGRPLDG--RPMVTH-RDYPLQNAPPSAFLRPRIRDPLSVGVRTVDGILTIGRGQRIGIFAGSGVGKSTL 172 Desulfitobacter...
WP_012544306  98 DGLVGRVVNAIGEPLDD--KGPVYG-EKRSVYQDPPHPLKRKIITEPLQTSIKAIDGLLTVGKGQRVGIFAGSGVGKSTL 174 Coprothermobact...
CAA39523     100 TGLIGQVIDAFGEPLD---ESFCRKVSPVSTEQSPPNPMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTL 176 Bacillus subtil...
WP_011416887 109 AGLLGRVIDGVGNPIDN--RGPIDTEEEYPLYAEPINPLARGRISDPIDFGVKVLNGLFSCGKGQRMGIFAGSGVGKSVL 186 Syntrophus acid...
WP_011343919  97 KSLLGKVLDGLGRPLN---ADKIYG-RHFSLDRKPPKPLHRRRIKKPFATGIKAIDGPLTCGEGQRLGIFAGSGVGKSTL 172 Carboxydothermu...
WP_011175946 114 PQLLGRILNGLGEPLDEetKGPLILEETYPVIQAPPDPVKRMPIHNPISVGIRAIDGVLTTGLGQRVGIFAAAGGGKSTL 193 Candidatus Prot...
WP_000570584 107 KELLGRVLNGVGRPIDK--KGHIITKEERPPDNEVPNPLDRPIIRDVLMTGVRAIDGILTIGRGQRVGIFSGSGVGKSSL 184 Leptospira inte...
WP_011065958 175 LGMIARNSSAEINVIALIGERGREVREFIENDLGPEGLKKSIVVVATSDQPALMRIKGAYTATAISEYFRDLGYKVNLMM 254 Oceanobacillus ...
WP_010898608 174 LAMLAKNAAADLNIIALIGERGREVKDFIERDLGEDGLRRSIIVVATSDQPALMRIKGAMTATALAEYFRDQGLHVNLMM 253 Bacillus halodu...
WP_011392295 176 LGMIARHSTADINVIALIGERGREVRDFIEGDLGPEGLARSIVVAATSDQPALVRIKGAFTATAIAEYFRDQGKNVLLMM 255 Moorella thermo...
WP_005816227 173 LGMMARNTTAGVNVIALVGERGRELRDFIEKDLGEEGLERSVLVVATSDQPALVRLKAAFTATAIAEYFRDQGQDVLLMM 252 Desulfitobacter...
WP_012544306 175 LGMIARNSSADVNVIILVGERGREVRKFIEEDLTEEGAKRSVVVVATSDQPALLRVKAVLTGMTIAEYFRDQGKDVLVMM 254 Coprothermobact...
CAA39523     177 MGMIAKQTEADLNVIALVGERGREVREFIEKDLGKEGLKRSIVVVATSDQPALMRLKAAYTATAIAEYFRDKGQNVMFMM 256 Bacillus subtil...
WP_011416887 187 MGMIARNTSADINVIGLIGERGREVREFLEKNLGKEGLARSVVVVAASDMHPLIRMRAAHVATTVSEYFRDQGRDVLLMV 266 Syntrophus acid...
WP_011343919 173 LGMIARYAEADVNVIALIGERGREVLDFIENDLG-EGIKKSVLVVATSEQPALFRVKGAFVATAIAEYFREQGKKVLLMM 251 Carboxydothermu...
WP_011175946 194 LGMIARNAVADVNVISLIGERGRELREFIEKDLGPEGLKRSVLVVSTSDQASQLRLNAAYVGTAIAEYFRDQGKSVILMM 273 Candidatus Prot...
WP_000570584 185 LGMIARYTDADINVIALVGERGREVNEFIEIDLGKEGLKKSVVLAATSDAPKMEQVNCALLATSIAEYFRDQGKHVNLMM 264 Leptospira inte...
WP_011065958 255 DSVTRVAMAQREIGLAVGEPPTTKGYTPSVFSILPKLLERTGT-N-ANGTITGFYTVLVDGDDMNEPIADAVRGILDGHF 332 Oceanobacillus ...
WP_010898608 254 DSVTRFAMAQREIGLAVGEPPTTKGYTPSVFALLPKLLERAGT-N-GKGSITGFYTVLVDGDDLNEPISDTVRGILDGHF 331 Bacillus halodu...
WP_011392295 256 DSLTRFAIAQREVGLAIGEPPTTRGYTPSVFASLPKLVERAGN-G-ERGSITGLYTVLVEGDDMNEPVADTVRGLLDGHI 333 Moorella thermo...
WP_005816227 253 DSVTRFAMAQREVGLTTGEPPATRGYPPSVFAMLPKLLERSGM-S-EIGSITGIYTVLVDGDDHNEPIADTVRGILDGHI 330 Desulfitobacter...
WP_012544306 255 DSVTRLAMAQREVGLSIGEPPTTRGYTPSVFALLPKILERAGN-S-DKGSITAFITVLVEGDDMNEPVADAVRSILDGHI 332 Coprothermobact...
CAA39523     257 DSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTGA-N-EHGTITAFYTVLVDGDDMNEPIADTVRGILDGHI 334 Bacillus subtil...
WP_011416887 267 DSLTRFAMAQREIGLSVGEPPTTKGYTPSVFSLLPKLLERAGKvE-GRGSITGLYTILVEGDDFNEPISDAARSILDGHL 345 Syntrophus acid...
WP_011343919 252 DSLTRFAMAQREIGLAAGEPPSSRGYTPSVFALLPKLVERAGN-D-DKGSITAFYTVLVEGDDFNEPIADAVRGLLDGHI 329 Carboxydothermu...
WP_011175946 274 DSVTRFARALREVGLAAGEPPARAGYTPSVFSTLPKLLERAGN-S-DKGSITAFYTILVAGDDMNEPVADEVRSILDGHI 351 Candidatus Prot...
WP_000570584 265 DSLTRFAQANREISASNHEPPITRGFSSSVFSKLAKLVERSGT-SkSGGTITGFYTVLTEADEMEDPIADAVRGYIDGHI 343 Leptospira inte...
WP_011065958 333 ILDRKLAERGQFPAINVLKSISRVMNVIADEEHKEQSQTLRKLLSTYEENQELITIGAYKKGTNHEIDQAISFQPYILEF 412 Oceanobacillus ...
WP_010898608 332 VLDRELANKGHYPAINILKSVSRVMNDIVTDEQKRAAEHVRSLLSVYKESEDLINIGAYKRGSSKQIDEAIERQPEVISF 411 Bacillus halodu...
WP_011392295 334 VLSRRLAAANHYPAIDVLQSISRLMPEITSREQQEQAGKLRDLLAAYQEAADLIEIGAYQAGSNPRVDAALKYHEAIQSF 413 Moorella thermo...
WP_005816227 331 VLTRELAMQNHYPAIDTLQSVSRVMNDIIAPEHKELAGKLREHLAVYHDAKDLIDIGAYVTGSNPRIDAAIRHIEGINGF 410 Desulfitobacter...
WP_012544306 333 VLSRALAHRAHYPAIDVLQSISRVMNDVVSAKHLKLANRMRELLAVYTEAEDLINIGAYQRGNNPKIDEALDYIDAINHF 412 Coprothermobact...
CAA39523     335 VLDRALANKGQFPAVNVLKSISRVMSNISTKQHLDAANKFRELLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQF 414 Bacillus subtil...
WP_011416887 346 YLSRELAAKNHYPAVDVLNSISRVMIDIVSEKHRNMANRILSIIAAHKKAEELINIGAYVHGSNAEIDYAIRMIDKVNDF 425 Syntrophus acid...
WP_011343919 330 VLSRQLAGKGHYPAIDLLASNSRLMPELVDEQHLALTLKMREILDIYRQNEDLILIGAYKPGTNPLLDRAIQLVPKINQF 409 Carboxydothermu...
WP_011175946 352 ILSSELARQYHYPAIDVLSSASRVMNAIVPKEHLQLVGKLKEVLANYKKNELLIKIGEYKRGADKAGDFAIDYIEKVLKF 431 Candidatus Prot...
WP_000570584 344 ILNRKLAEKNHYPAIDVPASLSRVMARIAPEDQNLRAGMIRELISVYNSAEELIRLNAYVSGSDPKVDLAIRKKDKIDRY 423 Leptospira inte...
WP_011065958 413 LKQGIHEKRTFDETIQMMKNLL 434 Oceanobacillus iheyensis
WP_010898608 412 LRQNTDEVAIAEHSIQQLIQAF 433 Bacillus halodurans
WP_011392295 414 LRQGKDEYFAFQDTLAALAGIL 435 Moorella thermoacetica
WP_005816227 411 LRQDVEEKVSFDQMLRQLQQAL 432 Desulfitobacterium hafniense
WP_012544306 413 LLQQVKESYTLEQTVSLMEEVL 434 Coprothermobacter proteolyticus
CAA39523     415 LKQGTDEPALLEESIAALTSLt 436 Bacillus subtilis subsp. subtilis str. 168
WP_011416887 426 LRQDIHERFDAEQTAGMMAAFF 447 Syntrophus aciditrophicus
WP_011343919 410 LQQKQNEKVDFTTTKEMLKTLF 431 Carboxydothermus hydrogenoformans
WP_011175946 432 LKQGVDEKCSFQETVQLLKSLF 453 Candidatus Protochlamydia amoebophila
WP_000570584 424 LKQKIQERSTYSHALQGLKEVL 445 Leptospira interrogans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap