Conserved Protein Domain Family
HpnE

?
TIGR03467: HpnE 
squalene-associated FAD-dependent desaturase
The sequences in this family are members of the pfam01593 superfamily of flavin-containing amine oxidases which include the phytoene desaturases. These sequences also include a FAD-dependent oxidoreductase domain, pfam01266. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of squalene, the condensation product of the polyisoprenoid farnesyl pyrophosphate. This gene and its association with hopene biosynthesis in Zymomonas mobilis has been noted in the literature where the gene symbol hpnE was assigned. This gene is also found in contexts where the downstream conversion of squalene to hopenes is not evidence. The precise nature of the reaction catalyzed by this enzyme is unknown at this time.
Statistics
?
PSSM-Id: 274593
View PSSM: TIGR03467
Aligned: 14 rows
Threshold Bit Score: 388.261
Threshold Setting Gi: 499449060
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506376261  20 SAACALSDAG------YRVQLLERRPYVGGRASSYEHPGTG----EVIDNCQHVLIGRCTNLIDLYARLGVPNAIR--W- 86
gi 499434760  16 SAAEALSRTGvfhrgeMQVVVAESRRNTGGRAGSFVESRSG----QTVDYCQHVAMGCCTTLLDLLQRMGLLDRFQ--C- 88
gi 499798958  20 aaaVRLTQAG------FKTTLFDASHQLGGRARSITWQGLS------LDNGQHILLGAYASSLELLQTCGVEIRTSl-L- 85
gi 497720450  29 aaavglagRG------FKVTVLESRNRLGGRAGSFRDPQTD----QLVDACQHVSMGCCTNFAHLLRTVGAEHLLS--P- 95
gi 500004579  15 aaaaalgRDG------WEVDLFEARPFLGGRATSYAVPSGGdeiaETIDNCQHVLLRCCINLLDFYQRLGVRDRIKf--- 85
gi 499558880  38 ACAVELARRH------VPVTVFERSHTLGGRARVVAKDGWR------VDNGQHILIGAYTELTRLLRLTGGSPKLl--E- 102
gi 499830394  16 SAGVRLADAG------CLVRVHEAAQQVGGRCRSYFDGATS----LTIDNGNHLVLSGNHSLLAYARRIGTEAGLQgpP- 84
gi 499607701  14 aaaVELTTAG------AETTLFEAGRVLGGRARGVEIDGRQ------LDNGQHILLGAYRDTLALMRRVGANPDELf-D- 79
gi 499631476  16 aaaLTLAEAG------VPVTLYEAGRVLGGRARAVELG--D----RVLDNGQHILLGAYTNTLELIARVHPAPRTPplW- 82
gi 499707090  24 ACAVRLVSHG------RAVSLHEAAGQAGGRCRSFVDASLD----RLIDNGNHLLLSGNRAVNAFLATIGASDRLDg-Pe 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506376261  87 YNQFTFVEPGGRES-VLRSTG-L-PAPMHSSLSFLAAKCFTVADKIAIARGLLAFVW-GlP--PDSGENFGAWLTRHGQT 160
gi 499434760  89 YSELTFYHPQHGFS-RFRPSR-WlPPPLHLSSALSSLKHLSRKNQREIRAALWRLMRtPeS--ELIDVTASVWLQANGQS 164
gi 499798958  86 RLPLKLEIPHEF---SLRSMPaL-PAPWHILGGLLQAQGLSFQERLAAVRFMASLRLqRfR--LPTDMPLHQVL--ASQP 157
gi 497720450  96 QPRLYFVTPDRRVS-VFKSDP-W-PAPFHLGRALMGAHYLTPLDKLRVAYGLGRMLLe--R--PDADPPLLPWLKAHFQN 168
gi 500004579  86 YREFFFIEPGGRIS-VLRRGK-L-PAPLHFTESFLGMHFLSFADKVGIGKALLALRReRnRrkDLDRISMLDWLLQKRQT 162
gi 499558880 103 HLPLTLHTPGHMH---LQAAR-L-PAPLHLAIGLLRATGLGWADRLAMLRLMRFLKKqRfR--VEAQLTVAELLRDTRQS 175
gi 499830394  85 KAEFQFIDLAVNKRwKLQIND-G-RVPFWVFDRSRRVPDTSPADYFALAPLVWAKTRtR----------VGDVIKCEG-- 150
gi 499607701  80 RRPLQVIDNTGF---RLALPR-L-PAPLNVAWGLLAASGVGMGEKLRTALWMDGIKRrGfK--LAYETTVAQWLDDAGQT 152
gi 499631476  83 RLPLAFDQPPDF---RLRCPR-L-PAPLHLAAGLLGARGLDWHEKLTAARWAAALIRg--A--ATPPGTVSELTR--GQP 151
gi 499707090  93 RARFPFLDVETGERwCLTPSA-G-PVPWWLLRADRRIPGTRARDYLEGLKLA--------R--ASDADRVADLLT---PG 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506376261 161 HGAIERFWKPVLVSALNEDPERISVHYAAKVFRESFL-SSARAGEMGIPSIPLSELYGH-AIDYITARGGEVRLRTSVES 238
gi 499434760 165 EDTLERFWDVILISALGDIPKRVSMAAARKVMIDGFA-GARHASDVWVPRRPLSEIFGDgFRKPLDQRGVAFELGHAVRE 243
gi 499798958 158 TRLITVLWEPLCLAALNTPIATASAQAFLNVLRDSFA-HKKSDSDLLLPRADLTTLIVEpAANFIQSHGGRVNLNAPITS 236
gi 497720450 169 ERTINRFWAIVLTSALNETVDRVGLKYARKVFRDGFV-RHRDAFTVHVPSVPLGRLYGDeLRGWLATHGVEVCENAGVKR 247
gi 500004579 163 PHAIDRFWRQVLVSAVNEDLDRMAAIHGFQVFWLGFL-ASADGYEMGVPNVPLGDLYTAeAWRRL----GNVRMHFRAPV 237
gi 499558880 176 ERLSRLVWEPLCVAALNTPVAEASAQVFASVLRDSLA-AGASASELLIPRVDLSELFPVpAARYLAVRRGKLRTGTAVEA 254
gi 499830394 151 -ALYKRLMLPLLLAALNIEPPDGSAGLAGAIIRETLL-AGGQACRPLIARDGLSSVLIEpAIDYIRARGGSVDVGHEVRQ 228
gi 499607701 153 GALRRHLWEPLCLAALNLPAERASAQLFANVLRDSLGsSRREDTDLLLPRVDLGQLLPEpAGHWLRSHGAEIRLSTRARE 232
gi 499631476 152 EKLRALLWHPLCISALNTPPETASAAVFASVIRAAFG-GRNAHSDLLLPRSDLGELFPVpAARRIVDAGGVVRLACRVSG 230
gi 499707090 158 TPLYRRFWAPLTVGVLNAAPEEAAAALLWPVIKETFG-RGEAACRPRMARNGLSDSFVTpALAWLTARGAEIAFNHRLRA 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506376261 239 IACSGTENRWRV-LSADET----FDADAVVLALPFEGMARL-LPqmpdapgkE----T----LGAKLAAFEHSPITGIHL 304
gi 499434760 244 LNWNAESNRWTIeRSGAES----LLADHVIVATPWHVSRRW-FP--------E----I----WGEQSTSFSSSPITGLHL 302
gi 499798958 237 LHAQDHGVRLKS-RTEEQD----FT--HVVIATSPFRVAPL-LQtlp---smE----D----IIAQCQALQYQPIYTVYL 297
gi 497720450 248 LLKGEGISGAAL-R-DGST----LTADWYVLAVPFDRVADL-LPg-------ElageP----YFGGANGLTPSPITSVHL 309
gi 500004579 238 ERIDGTGFMV-----GGEH----LTADRYICALPFERMESVgLPa-------P---------------KLEHSPITGIHL 286
gi 499558880 255 IRPVAGGFRLEG-DPADQR------YAHVVVAAAPHHAGAL-LAp-------L----DgcarLAAKIDALSSEPITTVYL 315
gi 499830394 229 LTMANGKVTALA-L-GDQTia-lGPGDAVVMAVPPRPAAAL-LPg--------------------LTVPTKFRAIVNAHF 284
gi 499607701 233 INAAENGIAIDG-ETFAAA----IIATA------PQHVGAL-WP--------------------AAETNYDYEPIATVYR 280
gi 499631476 231 LSARADGITTLL-GAGNQT----HAHSHAIIAVAPQHVKGL-AAsis---elG----D----AVAMLAHYDYQPIATGYV 293
gi 499707090 237 IEYGDGRPAALV-FS-EETplrlGPADQVVLAVPPAVAAGL-LPg--------------------LTVPEGSRCIVNAHF 293
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 506376261 305 WFDREI------TPLEHAVLLDSPVQWLFNKSALQPEHras-geHYIELVVSASRALVPMQRQEIVDLAVAELGRFFPAM 377
gi 499434760 303 WLDRSL------TPMPHVVMVGTLAQWFFQDPIQTIGNasptegVYHQVVISGQHARSDWPKEKLVSQVVRELSEAFPKA 376
gi 499798958 298 QYPSAIa-----LPQAMHGLAGKLGQWVFDRGQLYGQT------GLLAVVISAEGKHQALTQSDLATKIHQELQDVFPRQ 366
gi 497720450 310 WLDRPt------MKLPHAVLVDCLGQWVFDRGEVAPGE------FYLQVVVSAARDLKGLGREEIQRRIYEELGRLFPPV 377
gi 500004579 287 WFDREIt-----T-LPHATLLDRTMQWMFNKDGG----------RYLQLVVSASRDLTPLSRKEIIDIAVGDLRLYFPRV 350
gi 499558880 316 ALGAPLr-----LAHAMIGLVDGPAQWAFDRGRLGGPA------GLIACVISTHGTHEALSREALTLAVHAQLERQLGRR 384
gi 499830394 285 RFVPPP------HQPPMMGVVNGLIEWLFAFP------------DRFSITISGGDRLVDMPREELARAIWKDICAVAGIE 346
gi 499607701 281 NFEPGMt-----SAFPLSNRLGGHCQWVVDRGQ-----------GVLACVLSGHGDWEKLDDNALATALDQELGLTNPTG 344
gi 499631476 294 QYAPDFr-----LPKPFLALAEGPAQFAFDRGQSHAQP------GLIAFVASAAADL----PTDWLDRAEAQLRRS---V 355
gi 499707090 294 RLDHAPegfaddFEGPL-GVIGGTAEWLFVRG------------DVASVTVSAADALAALDPDEIAARIWRDVALALGLD 360
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 506376261 378 REATLVKAAVVKEVRATYSVRPGLDAVRPGAESPWPRMVLAGDWTATG-----WPATMEGAVRSGYQAAEAVTA 446
gi 499434760 377 GMPKVLKSRVVTDPHAVFSVSPETQVRRPASKTSCPGLHLAGDAVATG-----WPATMEGAAISGQLAANSVLE 445
gi 499798958 367 LGTPPLWHKVIAEKRATFACTAGLP--RPVQATPHPRIQLAGDYVSTGdafldYPATIEGAIRSGFQAAENIIK 438
gi 497720450 378 AQAKLLRAKVVTEHTATFSAVPGVDRWRPPQASPVWNLAVAGDWTDTG-----WPATMEGAVRSGYLAAEAILA 446
gi 500004579 351 REAKLVKAHVVKEQRATFAAAPETEVLRPGAVTPFPNLFIAGDWTRTN-----WPATMEGAVRSGYIAAEALAK 419
gi 499558880 385 LPAAE-WSQVITEKRATFACRPGLA--RPGPQTPLPGLWLAGDYLDPD-----YPATLESAVRSGVATAARVLQ 450
gi 499830394 347 AEM-PAW-QIVRERRATFEASPEQNALRPGARTEWKNLFLAGDWTDTG-----LPATIEGSVRSGNRAADLVLK 413
gi 499607701 345 ------WHKVIREKRATLSAQPGIH--RPDCRTTAPRIFLAGDYTWAD-----YPATLEGAVRSGRRAAQMAMA 405
gi 499631476 356 RPGRPQWRKRIVEKQATYACRPGMA--RPAVRTRHPRVFLAGDYTAGP-----YPATLESATQSGVQSAASLLE 422
gi 499707090 361 AAARP-PVRIIKEKRATFAQTPDQLCRRPPTRPPGYGLCLAGDWTHTG-----LPATIEGALRSGEAAADAALH 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap