3WJ7


Conserved Protein Domain Family
HpnA

?
TIGR03466: HpnA 
hopanoid-associated sugar epimerase
The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene. This gene and its association with hopene biosynthesis in Zymomonas mobilis has been noted in the literature where the gene symbol hpnA was assigned. Hopanoids are known to be components of the plasma membrane and to have polar sugar head groups in Z. mobilis and other species.
Statistics
?
PSSM-Id: 163279
View PSSM: TIGR03466
Aligned: 15 rows
Threshold Bit Score: 487.2
Threshold Setting Gi: 30249157
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3WJ7_A        14 DVTLVTGATGFVGSAVARVLEERGHRLRLLVRPTSDRSNIAELNAELAVGDLSDPDTLAPALKGVKILFHVAADYRLWVP 93
gi 499812432   7 DLVLVTGASGFVGSSVARIAQQKGFKVRVLVRATSPRQNVESLDAEIVVGDMRDEASMRNALRGVRYLLHVAADYRLWAP 86
gi 499243807   1 MKVFVTGATGFIGASIVRELLKDGCHVRVLARPGSDRRNLAGLDVEICEGDLRDRQALEHGLAGCEVLYHAAADYRLWTR 80
gi 499703040   3 GPVLVTGATGFVGAAIVRALLARGEAVRVLARPASDRRNVANLHVEVAEGRLEDAASLRKAMAGCRVLIHTAADYRIWVP 82
gi 499307631   1 MRVFVTGATGFVGANLVRLLLQQGYTVKTLVRPQSNLGNLRGLDVEIVEGDF-DNQFLWQQMSGCRYLFHVAAQYSLWQK 79
gi 499841810   1 MKAFVTGATGFVGSHVAELLEAMGAEVRVLTRKTSRSENLEMLKAERIVGDLRDFDSLKKGMAGCEVVFHVAADYRLWTR 80
gi 499559950  11 KPVLVTGVSGFVGSAVARSLAQQGYKVRGMVRATSPKTNIRDFPGEIVFGDLDDPPSLREPLSGCGALIHVAADYRLWAA 90
gi 501530512   1 MKALLTGASGFVGGAVLRRLLAEGLEIRVLHRTGADPANWEGLDVELVVGDLTDGPALDSAVAGCQAVFHVAADYRLWVP 80
gi 500002313   2 KPALVTGASGFLGWHVARVLVERGLHVRALVRPGSK---VVGIDVECVTGDLRDPASLALAVKGCGLVFHVAADYRLWAK 78
gi 506376267   1 MKVLVTGATGFVGSHVAKELAAQGASLRLLVRKTSNLANLEGLNAETVTGDLMEPESLRTAVRGCEALLHVAADYRLWVR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3WJ7_A        94 DPETMMKANVEGTRNLMLAALEAGVEKIIYCSSVAALGLRSDGVPADETTPVSESQVIGIYKLSKYRAEQEVLRLIREKN 173
gi 499812432  87 DPSEIERSNLEGTEATMRAALKEGVERIVYTSSVATLKVTSSGQSADETSPLKADQAIGVYKRSKVLAERAVERMIAEDN 166
gi 499243807  81 TPAAMYAANVDGTRNILEAALRRGIARVVYTSSVGTLGNPGNGTPGTETTPVTFADMVGHYKKSKFLAEREAEAFIAR-G 159
gi 499703040  83 DPAAMMKANVEGTRTLMEAALAEKVERVVYTSSVATLGH-VEGGVADEDTPSDISDKVGPYKQSKFLAEEVVRRMVAEQG 161
gi 499307631  80 DRDLLYQNNVLGTFQVLEAAQKAGIERTVYTSSVAAIGVNPSGEIADETYQSPVDKLIGHYKKSKFLA-EQEAVQAAAKG 158
gi 499841810  81 NPEEMYASNVEGTRSIIRAAQETGVRRVVYTSSVATMGFGYNGYIVNEATPVHAGMMIGHYKKSKFQAEQVALEMAQA-G 159
gi 499559950  91 DPNEIIRHNRLHTQAIMTAALYLGIERVIYTSSVATLA-PGHGKPSDENSPLMPENAIGAYKRSKVEAERLVEKMIAEQG 169
gi 501530512  81 DPRAMYAANVGGSERLVRAALDAGVERIVYTSSVAVLGHYADGREADEDTTAQLEDMIGHYKRSKYLAEEALRALCREEG 160
gi 500002313  79 DPTELYRSNVDGTRNLLEAARQAGVERTVYTSTVGCIGMPRDG-IGDEAQPVKLAHMAGDYKRSKFLAEKVALEFARA-G 156
gi 506376267  81 DPKQMYAANVEGTRALLQMAREEGVGRCVYTSSVATMAFREDGTIVDEATPVSVDDMVGHYKRSKFLAEQVALEAAAAG- 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3WJ7_A       174 LPAIIVNPSTPVGPRDIKPTPTGQMILDCASGNMPAYVETGLNIVHVDDVAEGHALALER--GKIGEKYILGGENIMLGD 251
gi 499812432 167 LPAVIVNPSTPIGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAAGHFLALER--GKIGERYILGGENLPLQQ 244
gi 499243807 160 LPLVIVNPSTPVGPHDVKPTPTGKIIVDFLNRKMPAYLDTGLNIIDVEDCARGHLLAARH--GRIGEKYILGHENLTLRE 237
gi 499703040 162 LPAVICSPSTPIGPGDVKPTPTGRMIVEAASGRMPAYVDTGLNIVHVDDVAAGHLLALDK--GRIGERYILGGENLTLAD 239
gi 499307631 159 QDIVIVNPSTPIGPWDIKPTPTGDIILRFLRRQMPAYVNTGLNLIDVRDVAWGHLLALEK--GKSGDRYILGHQNLSLQQ 236
gi 499841810 160 ADVVIVNPSTPIGERDIKPTPTGQIVVDFLKKKFPAYVDTGLNLVDVRECAQGHINAMER--GRSGERYILGGENLTLKQ 237
gi 499559950 170 LPAVIVNPSTPIGPRDVKPTPTGRIIIEAATGKMPAYVNTGLNLAHVDDVADGHVKALEK--GVIGERYILGGADVPLSV 247
gi 501530512 161 APIVIVNPSTPIGPADRKPTPTGRMVRDAAAGRMPAYVDTGLNVVHVDDVAMGHWQAFTD--GEVGERYILGGDNLPLAA 238
gi 500002313 157 QPVVIVNPTAPLGDHDVKPTPTGKIVLDFLKGDMPAFIDTGLNVVDVRDTAEGHWQACER--GRSGERYILGSENLTLAQ 234
gi 506376267 160 QAVIVLNPTTPIGPGDIKPTPTGRIVVDFLNRKFPAYMDTGLNLVDVKEVARTHVAALDPavGRPGERYILGGENLTLKQ 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3WJ7_A       252 LFRMVSQIAGVKPPAVKLKQSWLYPVALVSEWLA-R-GFGI-EPRVTRETLAMSKKLMFFSSDKAKKELGYAPRPARDAV 328
gi 499812432 245 MLADIAALTGRKAPTLSLPRWPLYPLAMGAEAIA-K-ITKR-EPFVTVDGLKMSKNKMYFTSAKAERELGYRARPYREGL 321
gi 499243807 238 IFALLARLTGIPAPRVRLPHTPILMAAYVNEALA-K-LTGK-EPLIPLAGVQMAKKFMFFESSKATGELGLQRRPAVDAL 314
gi 499703040 240 ILNRIAKITGGRPPLMKLPRWPLYPLALGAETWA-R-FFGG-EPFVTVDGLKMSRWHMFFSSAKAERELGYRHRPADEAL 316
gi 499307631 237 LLEKLAEITGLPAPQWTVPGWLPLSVAWMEEKIL-A-PLGK-TPSVPIDGVRMAQQTMYYDASKAVKELGLPQSPVDIAL 313
gi 499841810 238 ILDKLASISGLPSPKVKLPYAVALAAGAVDTVVT-GyIRGK-EPRANLDAVRMGRKKMYVSSAKAEADLGYKAGSANDGL 315
gi 499559950 248 MLAEIARQVGRKPPKVALPRWPLFPLAWGAEAFA-K-ITKK-EPFITSDALRMAGYHMYFSSEKAKRDLGYKSRPWQHAI 324
gi 501530512 239 ILTRIAGLTGHRSPWLRIPRRLLYPLAWGAERVV-R-LRGRgTPLVTVDELRMAAHKMYFSSAKAERVLHYTHRPAEEAL 316
gi 500002313 235 ILQKLAAITGRKAPTLQLPYALAYCAGACSTAWA-A-VTGR-PPRVPLEAVRMAKKKMWVSHDKAARELGFQPGPAEKAL 311
gi 506376267 240 ILDKMSAITGLPSPTMKVSHGVAMAFAFFDETIQgK-LLGR-EPRATVESVRMGRKKMFASSAKAQRELGFRVVPVYEAL 317
                        330
                 ....*....|...
3WJ7_A       329 TDAIAWFRQHGRM 341
gi 499812432 322 GDALEWFRQAGYL 334
gi 499243807 315 RRAVEWFRANGYA 327
gi 499703040 317 DAAVEWFKSIGEV 329
gi 499307631 314 KDAVNWFVSQGYV 326
gi 499841810 316 RRAAEWFRAHGYA 328
gi 499559950 325 SDAIEWFRAEGML 337
gi 501530512 317 RDAVRWFAEHHYL 329
gi 500002313 312 RHAVDWFRQTAa- 323
gi 506376267 318 REAIAWFRAHGYA 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap