Conserved Protein Domain Family
cellulose_yhjQ

?
TIGR03371: cellulose_yhjQ 
cellulose synthase operon protein YhjQ
Members of this family are the YhjQ protein, found immediately upsteam of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae. In several species it is seen clearly as part of the bcs operon. It is identified as a probable component of the bacterial cellulose metabolic process not only by gene location, but also by partial phylogenetic profiling, or Haft-Selengut algorithm (), based on a bacterial cellulose biosynthesis genome property profile. Cellulose plays an important role in biofilm formation and structural integrity in some bacteria. Mutants in yhjQ in Escherichia coli, show altered morphology an growth, but the function of YhjQ has not yet been determined. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 274549
View PSSM: TIGR03371
Aligned: 12 rows
Threshold Bit Score: 250.34
Threshold Setting Gi: 501971685
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499537652   5 MNRIVIVGLKGGVGGTTVTANLSHALHLLSKETITVDLAELNLLRLHFTMDINNDDGWAKHFS-NNEC--WSNASYESPQ 81
gi 499582919   1 MKRIIITGIRGGVGATTVAANLIQALKLNDESVHIIDVRPENLMRFHFAMDLSVQDGWAKRWL-NDES--WKNAAYISPN 77
gi 499810564   1 MKVIAVVSAKGGVGKTTLAANLASVLAASGRRVIALDLDPQNALRLHFGVPLDSIDGLSRATL-TGDP--WQTVMFDGVD 77
gi 499408365   1 MPVIALQGIRGGVGTTSIAAALGWAFQRLGESALVIDFSPDNLLRINFNMPFEQRRGWARAEA-DGAP--WQTGAMQYIP 77
gi 446201690   1 MAVLGLQGVRGGVGTTTITAALAWSLQMLGENVLVVDACPDNLLRLSFNVDFTHRQGWARAML-DGQD--WRDAGLRYTS 77
gi 499836223   1 MNTVAIVSTTGGAGRSTLTAELASLLAQRKHPALALECDPANVLGFHFGMREIPEDGLGAYLD-APTPgaWARAGQRSDD 79
gi 499448762   1 MAILSICGVRGGSGATALAAAIAWYREEQAQPTLAIDLCPQNLLRLHFGVPWSEQGGWRASLH-AGCD--WTESAWRIGS 77
gi 499618913   1 MKTIAIISAVGGAGRTTITAELASLLRWHGHAPLAIECDPRGLLGFHFGLRERVRQGLSNT-----AD--WAACGHRSDD 73
gi 499648084   1 mqrvfikgikggtggtSIVANLACALKKSDVDVIAIDLDAKSDLSLHFGLPWTQTLGWSNAET-FNDA---LSMFQQDSN 76
gi 499415922 121 AHVIAVVSAKGGVGKSTLSAALTSLVKVPGGQTLAIDLDPQDALQHHLNASPDVA-GLGGASL-SGEN--WRALLLNGSA 196
gi 497581877   1 MKTIAIVSTTGGAGRTMLTAALAVLLARGGRPVVALDFDGQNLLGVQLGLDAFAPAGISRALAgADAA--WHAYTWRNAD 78
gi 501971685 251 VPVLAIFSVAGGVGKTSLTANLGRALSSYGECPLLAETSIHGVLPFYFGARTPRPGVLRTFAS-NSAQ--EAPVQMLSLD 327
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499537652  82 RMR--FVPFGTLNSSELE---K----Y----CAHEEEWVaqLsg---eLSIVDMDAE-H-WQIIHLPNleHNQRVNREIL 143
gi 499582919  78 SLS--FIPYGGLTLDERL---I----FeqklMSTSQGLL--D------IFPIQPELEnM-WQIILLPTvhELNEHYDELL 139
gi 499810564  78 GVT--VLPYGALLEDDRRrfeA----Y----IDQEPRWLaqS------LQNLRLDAA-D-IVIIDTPP--GSSAYVRTAL 137
gi 499408365  78 GLD--FLPFGRLNTQEVA---TlqqhY----QQHPAIWQn-------nLTKLSAAGR-HrWVLIDVPA--GNSPLTRQAL 138
gi 446201690  78 QLD--LLPFGQLSIEEQE---N------------PQHWQtrLsdictgLQQLKASGRyQ-WILIDLPR--DASQITHQLL 137
gi 499836223  80 DVL--FVPWGSGGAPAAL---A----N----AAPD--WLgrL------LAQVDLPPR-G-VTLIDCAR--WPSPLADQAI 134
gi 499448762  78 GHLa-LVPHGTCAARGPE---P------------DAGWLsaE------LGKLERPAG-D-LVLLDTPS--WAGRCRDQAW 131
gi 499618913  74 GVL--FVPWGEPGARAAR---AdiamR----LHEDPHWLrrL------LQDVDLAGD-A-VTLVDSAP--WPSPFAEQAL 134
gi 499648084  77 GII--FLPFGDNSATAND---V-------------IDTVn-------nCQQLDLAPG-T-WMLYDCPS---HIDITHYSL 126
gi 499415922 197 DADtqLLAYGSLQLDERRsleR----F----QESDAHWLvrQ------IARMQLSAR-D-VVILDVPC--GDLLMLEQAL 258
gi 497581877  79 GVL--FVPYGHVDPAQAL---Acd-aR----LAADSGWLarV------LADVALPAA-G-VTLIDTAR--FPSQQAAHAL 138
gi 501971685 328 GDR--HIAEGD-----------------------QSNWLyeD------LRQSSREAK-R-IV-IDVSG--GMLGAIRQVL 371
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499537652 144 NSADLVIVVINPDPISYYLIRN---DSinyLelK----K----LVGGENKIKFLINNFQPESEVSQDFRLVLQKELTSM- 211
gi 499582919 140 ASADMVLCIAKPDIQNYAYIQQ---NV---F--F----R----RFVERYQPYYLINGYQPQSDNSVDLSLVLKYELDKQ- 202
gi 499810564 138 CAATFALNVVLADAASYAAIPQmerLI---DayA----A----PRAEFGGEGYVVNQIDQSRQLTKDVLKVLRQMLGAK- 205
gi 499408365 139 ATANTVFQVVVADANCHSRLHQ---QA---L----------------PRQCHFLVNQFSTLSTLQQDLHQLWLHTLSH-- 194
gi 446201690 138 SLCDHSLAIVNVDANCHIRLHQ---QA---L----------------PDGAHILINDFRIGSQVQDDIYQLWLQSQ-RR- 193
gi 499836223 135 AAADLVLVLAPAQPETCLTLRR---LA---DalT----A-------QGKTARYVATRLQPARQLHVDIVALLQAMLGQD- 196
gi 499448762 132 TAASHVLAVLTADSVNCVLAVR---LE---AelM----A----RGVPRDGILFAISQFDPARKLDRDVERVLRRTLGSR- 196
gi 499618913 135 AAADLALVLLPSLPESCATLAP---LR---QalD----D----G---GIASAYVVTRLQPGRQLHTDVSVLLRATLGDA- 196
gi 499648084 127 NHDDIFVELVNCDATCHSLIHK---RL---LalK----K-----SKNNWKHYFLVNKYNSASLLEFDLFALWQTTLPL-- 189
gi 499415922 259 NAASQVLVVLTADAACYLTLD----QM---QgwL----EpvlaGPQPPV-CHYVINQFDASRTFSRDMRDVMAKRLGGR- 325
gi 497581877 139 RCADLALCVVPPDPAACATAAA---RL---PelR----A----ASAG--ALRIVVNRLNPARDMQRDVLAMLRAAAGPGv 202
gi 501971685 372 RLNPVVVVPVLPDVSSVAAL-Q---AV---DdlFrnqpD----GSGKRIEPRFLLNQFDASLPLHRDVRDMLLQKYGER- 439
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 499537652 212 LLPVSLHRDTTVIDSIANLTNVHTTSPHSQAARDYQSLAFWCVTHLY 258
gi 499582919 203 CLPMFLHFDTAVPDACSQLNPVLNYAPHSQISQGINELSFWLLSHFS 249
gi 499810564 206 LFPGVIHLDEGVSEALACDTTLIHYDPLSQAAADFRACGTWLMTTVD 252
gi 499408365 195 LLPLVVHRDEALSESLMLKQPLGECRPDSVAAEEIMTLANWCLIHVK 241
gi 446201690 194 LLPMLIHRDEAMAECLAAKQPVGEYRSDALAAEEILTLANWCLLNYS 240
gi 499836223 197 MLPYHVHDDSSVAEALARSESFCRSTPHSQAAHDMNGLASWLSAWLE 243
gi 499448762 197 LAPRPVTRDEAVREALAAGLPVSVFAPESQAVDDLRQLAVWLAVKLR 243
gi 499618913 197 LLPYEIHEDAGVPEALARGECFCRSTPHSQTAHDLQGLASWVSGWLL 243
gi 499648084 190 IAPFFINHDEVVKEATAYRNVAFNYAPYSVANDDIETLAGWLVSKAA 236
gi 499415922 326 LL-GIVHKDNALAEALAYGHNAVQVPSASPGTQDLRVLSHLLITKLL 371
gi 497581877 203 VLEQRVHLDAALPEALARGTWFFDDAPHSQASHDLHGVAGWVDAWLD 249
gi 501971685 440 LLPFVIHRSPAVSEALAEGLTVLDYAPASEVASDILHFAGWVRSLAN 486
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap