4ADB


Conserved Protein Domain Family
arg_catab_astC

?
TIGR03246: arg_catab_astC 
Click on image for an interactive view with Cn3D
succinylornithine transaminase family
Members of the seed alignment for this protein family are the enzyme succinylornithine transaminase (EC 2.6.1.81), which catalyzes the third of five steps in arginine succinyltransferase (AST) pathway, an ammonia-releasing pathway of arginine degradation. All seed alignment sequences are found within arginine succinyltransferase operons, and all proteins that score above 820.0 bits should function as succinylornithine transaminase. However, a number of sequences extremely closely related in sequence, found in different genomic contexts, are likely to act in different biological processes and may act on different substrates. This model is desigated subfamily rather than equivalog, pending further consideration, for this reason. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 274490
View PSSM: TIGR03246
Aligned: 9 rows
Threshold Bit Score: 751.191
Threshold Setting Gi: 504730690
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ADB_A         5 ITRENFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVL 84  Escherichia col...
WP_000082019   5 ITRENFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNESVL 84  Escherichia coli
WP_010955178   8 VQRADFDQVMVPNYSPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVNALGHCHPALVKALTEQANTLWHVSNVFTNEPAL 87  Pseudomonas putida
WP_011147326   5 IQRSWFEHYMVPCFSPAKFIPVRAKGSKVWDQDGKEYIDFAGGIAVNSLGHAHPELKDELIYQIDKIWHIGNGYTNEPVL 84  Photorhabdus lu...
WP_011395851   6 VTREMFDQVMVPNYAPGPIIPTHGIGSRVWDQAGKEYIDLAGGIAVTGLGHAHPELVAALTEQAQKLWHLSNVLANEPAI 85  Hahella chejuensis
WP_011041486   7 VERGLFDDVMVPNYAPSAVIPVRGQGSRVWDQQDKEYIDFAGGIAVSALGHCHPALVGALKEQGEKIWHLSNVQTNEPAL 86  Colwellia psych...
WP_004925874   6 LNRQDFNQFMVPVFAPAQFIPVRGQGSRLWDQDDKEYIDFAGGIAVNALGHAHPIAVNALIEQGQKLWHIGNGYTNEPVL 85  Acinetobacter
WP_014917792  30 VSRQTFDEVMVPVFSPAPFIPDRGEGSRVWDTEGRDYVDFAGGIAVTALGHGHPELLKVLDEQSRKLWHIGNGYTNEPVL 109 Burkholderia ps...
WP_002212032  39 VTRQSFDEWIVPTYAPADFIVVRGEGSTLWDQQGKSYIDFAGGIAVNALGHGHPAVRAALIEQADKVWHLGNGYTNEPVL 118 Yersinia
4ADB_A        85 RLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGS------HKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDF 158 Escherichia col...
WP_000082019  85 RLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGS------HKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDF 158 Escherichia coli
WP_010955178  88 RLAHKLVDATFADRAFFCNSGAESNEAAFKLARRVAHDRFGP------QKHEIIATVNSFHGRTLFTVSVGGQPKYSDGF 161 Pseudomonas putida
WP_011147326  85 KLAKRLVENTFADKAFFCNSGAEANEAALKLARKYAADKYGK------NKNEIISFKDSFHGRTLFTVTVGGQPKYSQDY 158 Photorhabdus lu...
WP_011395851  86 LLAKKLTEMTFADRVFFSNSGGEANEAAFKLARRYSWEKHGP------HKHDIVACNNSFHGRTLFTVSVGGQAKYREGF 159 Hahella chejuensis
WP_011041486  87 RLAKKLVDSTFAEKVYFCNSGAESNEAALKLARRWALDVHGA------DKSQIIAFKQGFHGRTFFTVTVGGQAAYSDGF 160 Colwellia psych...
WP_004925874  86 ALAKQLVDHTFADKVFFCNSGAEANEAALKLARKIGLSK---------NKSKIVAFNNAFHGRTLFTVTAGGQPKYSQDF 156 Acinetobacter
WP_014917792 110 RLAKRLESLTFADRAFFANSGAEANEAALKLARRVAFERHGA------DKYEIVSFLQSFHGRTFFTVSVGGQSKYSEGF 183 Burkholderia ps...
WP_002212032 119 RLAKQLIDATFAEKVFFCNSGAEANEAALKLARKYALDNFANkagqqgEKNQIVAFRNAFHGRTLFTVSAGGQPKYSQDF 198 Yersinia
4ADB_A       159 APLPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAY 238 Escherichia col...
WP_000082019 159 APLPPDIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAY 238 Escherichia coli
WP_010955178 162 GPKITGISHVPYNDLEALKAQISDKTCAVVIEPIQGESGVVPADKAYLEGARKLCDEHNALLIFDEVQTGVGRTGSLYAY 241 Pseudomonas putida
WP_011147326 159 APLPQEITHLPYNNLSAIREHISENTCAVIVEPIIGEGGVIPADPAFLQELRTLCDRFQALLIFDEIQTGVGRTGYLYAY 238 Photorhabdus lu...
WP_011395851 160 EPVPGGIKHAPFNDIAALEAAIDENTCAFVVEPVQGEGGVTPADEAYLKRARELCDQHNALLIFDEVQTGVGRTGALYAY 239 Hahella chejuensis
WP_011041486 161 GPKPGDIDHAEYNNLDSLKALISDKTCAVMIEPLQGEGGIVSPTDEFIKGVRALCDQHNALLIFDEVQTGVGRLGELYAY 240 Colwellia psych...
WP_004925874 157 APLPAGIEHVAFNDLNAAAAVIDDQTCAVIVEPIQGEGGVLPADLEFLKGLRRLCDETGAVLIFDEVQTGVGRTGALYAY 236 Acinetobacter
WP_014917792 184 GPVPEGIKHLPFNDIAAAQAAIGPKTCAVIVEPIQGEGGVIPADPAFLKALREACDAHGALLIFDEVQTGVGRTGHFYAY 263 Burkholderia ps...
WP_002212032 199 APLPGGIHHGIFNDLASAEHLITDQTCAVIVEPIQGEGGVLPADKEFLHGLRALCDRHNALLIFDEIQTGVGRTGELYAY 278 Yersinia
4ADB_A       239 MHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVER 318 Escherichia col...
WP_000082019 239 MHYGVTPDLLTTAKALGGGFPVGALLATEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVER 318 Escherichia coli
WP_010955178 242 QHYGVIPDILTSAKSLGGGFPIGAMLTTTELAKHLAVGTHGTTYGGNPLGCAVACAVLDVVNTPETLAGIKAKHERFKTR 321 Pseudomonas putida
WP_011147326 239 QEYGVEPDILTSAKGLGGGFPIGAMLTKQHIAAVFQPGTHGTTFGGNPLATAVANKVLSIVNQAELLTGVLQRHDYFMDK 318 Photorhabdus lu...
WP_011395851 240 MKYGVTPDILTTAKAMGGGFPIGAMLTTTEVAQSLTVGTHGSTYGGNPLGCAVANKVMDIVNTPEVLQGVERKHELMVSG 319 Hahella chejuensis
WP_011041486 241 MDLGVTPDILTSAKGLGGGFPIGAMLTTTEIAKHLKIGTHGSTYGGNPLACAVSEAVLDTVNTTEVLAGIKAKAKLYVDG 320 Colwellia psych...
WP_004925874 237 MNTGVVPDILTTAKALGGGFPIGAMITTDQYANVFVVGDHGTTYGGNPLACAVAGAVFNFINTADVLDGVKQRSQQFIDE 316 Acinetobacter
WP_014917792 264 MDTGVTPDILTTAKALGNGLPIGAMLTTEALAAHFKVGVHGTTYGGNPLASAIAEKVVELVGDPALLEGVKQRSARLTAT 343 Burkholderia ps...
WP_002212032 279 MHYGVSPDVLTSAKALGGGFPIGAMLTTTKYASALSVGSHGTTFGGNPLACAVAGTVLSLINQPTLLAGVKARHQWFIDE 358 Yersinia
4ADB_A       319 LNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACE 398 Escherichia col...
WP_000082019 319 LNIINHRYGLFNEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAVACE 398 Escherichia coli
WP_010955178 322 LEQIGQQYNLFSQVRGVGLLLGCVLTEAWKGKAKDVLNAAEKEGVMVLQAGPDVVRFAPSLVVEDADIDEGLDRFERAVA 401 Pseudomonas putida
WP_011147326 319 LSKLNQRYQIFSCLRGKGLLLGAELDKAWQGKAKQLTNLAAEEGLIALIAGPDVLRFAPALNIEFADIDEGLVRLESAIM 398 Photorhabdus lu...
WP_011395851 320 LQAINEKYGVFSAVRGMGLLIGAALTDEWQGKAKQFMTAALEEGVLALIAGPNVLRLAPSLIIGDDDIKEGLARFERAVA 399 Hahella chejuensis
WP_011041486 321 LNAINAKYNVFSEIRGKGLLIGAVLTEKYQGQAKTFLNAAMDEGVMVLVAGASIIRFAPSLVIPDEDIALGLARFEKAIV 400 Colwellia psych...
WP_004925874 317 LEQLNHTYAVFQEIRGQGLLLGCVLRPEYAGKAKDIVTLAGAEGLLALIAGPNVVRFTPSLVISEQEISEGLQRFGRALS 396 Acinetobacter
WP_014917792 344 LEKINARFKLFKEIRGKGLLIGAELVGALDGRAKDFVSAAAEHGVIMLIAGPNVLRFAPSLVIPLDVLDEGLARFEKAVE 423 Burkholderia ps...
WP_002212032 359 LAEINARHNVFAEIRGRGLLIGCVLNAQYAGKSKEIVQAAAQYGLIALIAGPDVVRFAPSLIISPKEIKEGLARLAMGIE 438 Yersinia
4ADB_A       399 HFV 401 Escherichia coli BW2952
WP_000082019 399 HFV 401 Escherichia coli
WP_010955178 402 TLT 404 Pseudomonas putida
WP_011147326 399 RFV 401 Photorhabdus luminescens
WP_011395851 400 RVA 402 Hahella chejuensis
WP_011041486 401 SLV 403 Colwellia psychrerythraea
WP_004925874 397 QFV 399 Acinetobacter
WP_014917792 424 QVL 426 Burkholderia pseudomallei
WP_002212032 439 QVC 441 Yersinia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap