1E5M,4QAV,1J3N,2GQD,4JGA


Conserved Protein Domain Family
fabF

?
TIGR03150: fabF 
Click on image for an interactive view with Cn3D
beta-ketoacyl-acyl-carrier-protein synthase II
3-oxoacyl-[acyl-carrier-protein] synthase 2 (KAS-II, FabF) is involved in the condensation step of fatty acid biosynthesis in which the malonyl donor group is decarboxylated and the resulting carbanion used to attack and extend the acyl group attached to the acyl carrier protein. Most genomes encoding fatty acid biosynthesis contain a number of condensing enzymes, often of all three types: 1, 2 and 3. Synthase 2 is mechanistically related to synthase 1 (KAS-I, FabB) containing a number of absolutely conserved catalytic residues in common. This model is based primarily on genes which are found in apparent operons with other essential genes of fatty acid biosynthesis (GenProp0681). The large gap between the trusted cutoff and the noise cutoff contains many genes which are not found adjacent to genes of the fatty acid pathway in genomes that often also contain a better hit to this model. These genes may be involved in other processes such as polyketide biosyntheses. Some genomes contain more than one above-trusted hit to this model which may result from recent paralogous expansions. Second hits to this model which are not next to other fatty acid biosynthesis genes may be involved in other processes. FabB sequences should fall well below the noise cutoff of this model. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 274452
View PSSM: TIGR03150
Aligned: 75 rows
Threshold Bit Score: 525.512
Threshold Setting Gi: 499757128
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1E5M_A         7 KRVVVTGLGAITPIGNTLQDYWQGLMEGRNGIGPITRFDASDQACRFGGEVKDFDATQFLDRKEAKRMDRFCHFAVCASQ 86  Synechocystis s...
WP_011172503   2 RRVVVTGLGALTPIGVGQEAFHKAQLAGKSGVRPITRFDASALPVRIAAEV-DVDPGAYLDRKELRRLDRFVQYALIAAQ 80  Thermus thermop...
WP_011195092   3 RRVVVTGMGLISPLGNSVRANWEAAVAGRSGIGPITRFDASRLPTRFAGEVRDFDPATVMDPKEVRRYDPFIHYALAAAA 82  Symbiobacterium...
WP_012257003   3 RRVVVTGMGAISPLGLSVAELWQGIVAARSGVGPITLFDSTGFDTRFAAEVKGFDPTNYMDRKEARRTDRFVQFAVAATR 82  Chloroflexus
WP_010933772   2 KRVVVTGIGVLSPIGLSAGAFWNALMEGKSGAAPITYFDTTNFATTFACELKNFKADEYIDRKSADRMDPYCQYGVISAE 81  Chlorobaculum t...
WP_005783836   4 KRVVVTGLGAITPVGNNVPEFWENLVNGVSGAGPITHFDASQFKTQFACEVKGFDATQYIDRKEARKMDLYTQYAVAVAK 83  Bacteroides
WP_010888574  21 KRVVITGLGPVTPIGVGAKAYAEAQRAGKNGIGPITRFDAKDTASKIAGEVHD-SLDDFVDPREARKLDRYTLLALSAAE 99  Deinococcus rad...
WP_004080861   2 KRVVITGMGIVSPFGVGKERNLEGLRETKVTIDRISSFDASNLPVQIAAEVRDFKPEEYINPKLVRRTDRFVHFALVSAK 81  Thermotoga
WP_011437862   6 RQVVVTGLGATTPLGGDVASTWEGLLSGRSGVRRLTEGWVEQLPVHIAAPLA-VEPP--LGRVEARTLDRSQQMALTAAR 82  Frankia
1J3N_A         2 RRVVVTGLGALTPIGVGQEAFHKAQLAGKSGVRPITRFDASALPVRIAAEV-DVDPGAYLDRKELRRLDRFVQYALIAAQ 80  Thermus thermop...
1E5M_A        87 QAINDAKLVINELNADEIGVLIGTGIGGLKVLEDQQTIL---LDKGPSRCSPFMIPMMIANMASGLTAINLGAKGPNNCT 163 Synechocystis s...
WP_011172503  81 LALEDAGLKPEDLDPERVGTLVGTGIGGMETWEAQSRVF---LERGPNRISPFFIPMMIANMASAHIAMRYGFTGPSSTV 157 Thermus thermop...
WP_011195092  83 EAVEDAGLTFEGELAERTGVVFGSGMGGLEGIVENALIL---QERGPRRISPFFVPRCIINSAAGLISMKYGVHGPNYGT 159 Symbiobacterium...
WP_012257003  83 EALRDAELEITPANRDEIGVFIASGIGGIGTLSEQLDVL---RSRGPGRISPFLIPAMITNLAAGQVSIVTGARGPSYCV 159 Chloroflexus
WP_010933772  82 QALKDSGLDLTAIDPTRIGVVHGSGIGGMTVYDQQFRQY---LERGPRRVSPFFIPMLIPDIAAGQISIRNGLMGPNYAT 158 Chlorobaculum t...
WP_005783836  84 EAVADSGLDIENEDLNRIGVIFGAGIGGIRTFEEETSNYalhKENGP-KYNPFFIPKMISDIAAGQISIMYGFHGPNYAT 162 Bacteroides
WP_010888574 100 LAVRDSGLSAEDLRGERTGTLVGSGIGGMKTFEDQARVY---VERGAGRISPMFIPMQIANMATGHIAMRYGAMGPSSTV 176 Deinococcus rad...
WP_004080861  82 EAVEDAGINFEPY-ADRTATIIGSGMGGFLTLDSENNKF---LSQGPSRVSPFLIPMILIDMASGVVAMEYGLKGPNFSS 157 Thermotoga
WP_011437862  83 EAWADAGS--PEVDQERLAACVASGIGGVLTLLHQHDVI---REKGPRRVSPHLVPMLMPNGPASTVGLAFGAKAGVHAP 157 Frankia
1J3N_A        81 LALEDAGLKPEDLDPERVGTLVGTGIGGMETWEAQSRVF---LERGPNRISPFFIPMMIANMASAHIAMRYGFTGPSSTV 157 Thermus thermop...
1E5M_A       164 VTACAAGSNAIGDAFRLVQNGYAKAMICGGTEAAITPLSYAGFASARALSFRNDDPLHASRPFDKDRDGFVMGEGSGILI 243 Synechocystis s...
WP_011172503 158 VTACATGADALGSALRMIQLGEADLVLAGGTEAAITPMAIGAFAVMRALSTRNEEPEKASRPFTLSRDGFVMGEGAGVLV 237 Thermus thermop...
WP_011195092 160 VSACASAGHAIADAMHIIRRGDADVMITGGSEATITELAFAGFSSAKALSTRNDDPQGASRPFDADRDGFVMSEGAGCLV 239 Symbiobacterium...
WP_012257003 160 TSACASSAHAIGEAAETIRRGWAKAIIVGGSEASITPIGVAGFNAMRALSTRNEDYAHASRPFDAERDGFVMGEGAAVLI 239 Chloroflexus
WP_010933772 159 ASACATSLHAIMDAVMLLQMGMADYMVCGGSEAPITQMSVAGFNSAKALSTRNDAPTKASRPYDVDRDGFVMGEGAGSLV 238 Chlorobaculum t...
WP_005783836 163 CSACATSTNAIADAFNLIRLGKANVIVSGGSEAAIAAAGVGGFNAMHALSTRNDEPQSASRPFSASRDGFVMGEGGGCLI 242 Bacteroides
WP_010888574 177 VTACATGTGAIGEAARYIQLGLADVMLAGGAEASITAMAVGGFSNMKALSTRNDDPEHASRPFSATRDGFVLSEGAGVVV 256 Deinococcus rad...
WP_004080861 158 VSACASSLHAVALGALLIRHGYADVAVVGGTEATIAPLPITGFANMRALSRRNDDPKRASRPFDKDRDGFVMGEGGAVLI 237 Thermotoga
WP_011437862 158 VSACASGSEAIALALDIIRAGRADVVIAGGTEAAISALTMAGFAQMQALSRRNDAPEAASRPFDKARDGFVLGEGAAILI 237 Frankia
1J3N_A       158 VTACATGADALGSALRMIQLGEADLVLAGGTEAAITPMAIGAFAVMRALSTRNEEPEKASRPFTLSRDGFVMGEGAGVLV 237 Thermus thermop...
1E5M_A       244 LEELESALARGAKIYGEMVGYAMTCDAYHITAPVPDGRGATRAIAWALKDSGLKPEMVSYINAHGTSTpANDVTETRAIK 323 Synechocystis s...
WP_011172503 238 LEAYEHAKKRGARIYAELVGFGRSADAHHITEPHPEGKGAALAMARALKDAGIAPEQVGYINAHGTSTpAGDRAEVLAIK 317 Thermus thermop...
WP_011195092 240 LEELEHARRRGARIYAELAGAGMSGDAYHITAPHPEGRGAVLAMKGALRSARLNPEDVGYINAHATSTdLGDVQESLAIE 319 Symbiobacterium...
WP_012257003 240 LEDLEFALARGARILAEVVGYGATSDAYHISNLAEDGEGVARAIRLALQRGALAPEDVDYINAHATSTpAGDPVETTAIK 319 Chloroflexus
WP_010933772 239 IETYESAVKRGAKIYAEIVGMGASADAYHLTAPHPEGLGACSAMTTALNMAGITPDKIDYINTHGTATpLGDLAEIKAIK 318 Chlorobaculum t...
WP_005783836 243 LEELEHAKARGAKIYAEVAGVGMSADAHHLTASHPEGLGAKLVMKNALEDAEMSPEEVDYINVHGTSTpVGDISEAKAIK 322 Bacteroides
WP_010888574 257 LEEYEHAKARGATIYAEVAGFGVSADAYHITMPAPQGAGAQLAMKMALHTAGVNPEQVGYINAHGTSThFNDLHETQAIQ 336 Deinococcus rad...
WP_004080861 238 LEAEEVAKSRGAKILAEIKGVGMTDDAYHFSAPDPEGRGAAEAMKLALKESSLAVEDIDYVSCHATSTpAGDEAELKAIK 317 Thermotoga
WP_011437862 238 LEAAEHAAARGARVHGTLAGAGISSDAYHIAAPEPTGAGAARAIRAALRSGSLEPRDVVHVNAHATSTpAGDAAEALALR 317 Frankia
1J3N_A       238 LEAYEHAKKRGARIYAELVGFGRSADAHHITEPHPEGKGAALAMARALKDAGIAPEQVGYINAHGTSTpVGDRAEVLAIK 317 Thermus thermop...
1E5M_A       324 QALGNHAYNIAVSSTKSMTGHLLGGSGGIEAVATVMAIAEDKVPPTINLENP--DPECD---LDYVPGQSRALI-VDVAL 397 Synechocystis s...
WP_011172503 318 RVFGDHAKRLMVSSTKSMIGHLLGAAGAVEAIATVQALYHGVIPPTINLEDP--DPELD---LDFVP-EPREAK-VDYAL 390 Thermus thermop...
WP_011195092 320 QVFGDHARKLAVSGTKSMHGHLLGAAGAIEAILTVLSLYHQVLLPTINLHRP--DPECR---LDYVPHTAREVRgVEAAL 394 Symbiobacterium...
WP_012257003 320 QVFGGREKSPPVSASKSQFGHLLGAAGAIEAVVTILAMQNNLLPATINLQQP--DPACD---LDFVPGQPRPAR-IEVAL 393 Chloroflexus
WP_010933772 319 KVFGEHASKLSISSTKSMTGHLLGAAGVVESIACILALQNQTVPPTINLDNV--DPEID---VDVTPNVPKQRS-IEYAL 392 Chlorobaculum t...
WP_005783836 323 EVFGEHAFELNISSTKSMTGHLLGAAGAVESIASILAIKNGIVPPTINHAEGdnDENIDy-nLNFTFNKAQKRE-INVAL 400 Bacteroides
WP_010888574 337 HVFGDHAAQLAVSSTKSMTGHLLGAAGAIEAIAVAQALADGLLPPTINLTDP--DPELP---LDFIPEGARERQ-VDYAL 410 Deinococcus rad...
WP_004080861 318 KVLGEHVKNVAINSSKALIGHLLGAAGASELVLAILQMQNSFVHGMPNLDNP--IDEAKgtgL--VGKEPVQME-IKNFI 392 Thermotoga
WP_011437862 318 SAFGDHIDEIAVTSTKSTTGHLLGAAGAVEAVFSVLALREHLVPATRNLDAL--DDEIA---LDVVRIDNRTIR-PGAAL 391 Frankia
1J3N_A       318 RVFGDHAKRLMVSSTKSMIGHLLGAAGAVEAIATVQALYHGVIPPTINLEDP--DPELD---LDFVP-EPREAK-VDYAL 390 Thermus thermop...
1E5M_A       398 SNSFGFGGHNVTLAFK 413 Synechocystis sp. PCC 6803
WP_011172503 391 SNSFAFGGHNAVLVFK 406 Thermus thermophilus
WP_011195092 395 CNNFGFGGTNVSLAFR 410 Symbiobacterium thermophilum
WP_012257003 394 SNSFGFGGHNVCLAFR 409 Chloroflexus
WP_010933772 393 nngfgfgghngclifr 408 Chlorobaculum tepidum
WP_005783836 401 SNTFGFGGHNACVIFK 416 Bacteroides
WP_010888574 411 SNSFAFGGQNAALLLG 426 Deinococcus radiodurans
WP_004080861 393 KNSFGFGGHNVSIVVG 408 Thermotoga
WP_011437862 392 SNSFGFGGHDICLAFT 407 Frankia
1J3N_A       391 SNSFAFGGHNAVLAFK 406 Thermus thermophilus HB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap