Conserved Protein Domain Family
EpsA

?
TIGR03020: EpsA 
transcriptional regulator EpsA
Proteins in this family include a C-terminal LuxR transcriptional regulator domain (pfam00196). These proteins are positioned proximal to either EpsH-containing exopolysaccharide biosynthesis operons of the Methylobacillus type, or the associated PEP-CTERM-containing genes.
Statistics
?
PSSM-Id: 274393
View PSSM: TIGR03020
Aligned: 5 rows
Threshold Bit Score: 324.812
Threshold Setting Gi: 499630130
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26005747    7 LTDIEKAQLIDLMHESLRIRSHFEFFLWMQGKLQQFLPHEIMITAWGDFSMGVIYFNIVSPLPGVRTEKISSGDLNP--L 84
gi 123253942  17 LTPDQASAFLEVVDASLRIKKKAQLFSWLQGHFQFLLPHEVLLCGFAVGVGRNFSLETFSSTRYVTDAQVAIAMHERtgV 96
gi 499701133   8 LTEREAEYLFRIIDSSINIFRRHQFFLWAQGELQGLLPHGMLICLFDEGNGQAVNIERFS-RTDMDEIRFSELCRPDggI 86
gi 499698866   7 FTDDHLQRYFRILQEGTAVRRHFDLLKWLQGEVQHYLPHEILLAAWGDFGSNNVQYDIISPLPGLRTAQLQLARLSP--L 84
gi 499630130   7 LGDEDCGHLARILLASRRVNLRHNFFSWVHGPVQSLIPHEILLCGIAD-EGGYLLHQRFTACRYFKDDHYHRVIHPAdgL 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26005747   85 LKRLFNYWLShTKAPFTlsaENGVFQDCDVLPAEV------NSHLKNMKSALVHGIKDFRGRHDCLYILLNSTPTMPNTS 158
gi 123253942  97 VMKAIQAWRQ-TSQPVL---IDPYLKDGNFGRFTVpkidqvNLQESELRNIAAYGLSSADGSISSFFSFSRISGELNASH 172
gi 499701133  87 VFRAMSAWSAgKNQPLLv--CPNNSHTPTYKRFSN------DLKRENLQRIAAHGMFDTNGRTTCFFTFTQISAALSERH 158
gi 499698866  85 LRVSYNRWIEvGRIPCVsrvCEAQLDVSGILQGDGaahcpfGRALRNMRSSLFHGISDERGHHDCLYVVFSSKDKLDDST 164
gi 499630130  86 IHQLTHEWGA-KREPRLi--AALTDDPDGWHR---------RLLDLELKNLAFHGLCRVDGQMWGYASFSRLRVPFDARL 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26005747  159 RYMLESLLPYIDSALRQLEHLPvQH---PADKEASedlheeeneaLEQLSSREIEIMEWVRNGKTNQEIGMILDISSFTV 235
gi 123253942 173 AYMLELLVPYLHSVLMRVSDGVfNFg-dAMGEGVN----------AGIITPREKEILQWVHTGKSNWEIATILEISPLTV 241
gi 499701133 159 AYFLELLMPHMHMALVRMLFHErHHkqgAVGER-S----------RKLITDRETEILRHVQAGKSNHEIAQLLYISPLTV 227
gi 499698866 165 LIAMEILLPYLDTALRRVTPLP-QHscrPSLLADApe------ydLHGLSEREVEIMTWVRKGKTNAEIGSILRISSYTV 237
gi 499630130 154 ALFMELLLPHLLVTLARV--LAnEArtrSLGDRH-----------AGLITAREAEVLAWVRDGKTNEEIAAILGLSMLTV 220
                        250       260
                 ....*....|....*....|....*
gi 26005747  236 KNHLQRIFKKLDVLNRAQAVSKFKQ 260
gi 123253942 242 KNHMQNILRKLDVQNRSHAAAKAYR 266
gi 499701133 228 KNHIQKILKKLDVNNRAHAVAKAMA 252
gi 499698866 238 KNHLHQIFRKLDVYNRVQAISKIEQ 262
gi 499630130 221 KNHLRHAMQKLVVRTRGQAVARAIA 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap