Conserved Protein Domain Family
Sig-70_X6

?
TIGR02999: Sig-70_X6 
RNA polymerase sigma factor, TIGR02999 family
This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found in a variety of species including Rhodopirellula baltica which encodes a paralogous group of five.
Statistics
?
PSSM-Id: 132044
View PSSM: TIGR02999
Aligned: 14 rows
Threshold Bit Score: 190.607
Threshold Setting Gi: 21244845
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499353743   8 DVPVTELLTQWQNGDE--------------------TAYDELFIQCYQQFRHQIRKSKIQNLNNQQT----------Nvn 57
gi 499436207   1 MAKVTQIINQIQSGNA--------------------AASD-LLPLVYEEMRRLARHKMQNEAVGQTL----------Q-- 47
gi 499436060   2 MSSITQILQSSQNGDA--------------------AKTDQMFSFLYDDLRRMAGRFLQSEPRRERL----------S-- 49
gi 499433059  13 ETEVSMLLQQVKDGDE--------------------EAREKLFVTLQSELRDMAGALMRGERPDHTL----------Q-- 60
gi 499965791   2 SRAIRKAVPDQAQRDQ--------------------SCRHKLSAEAYDLLRAIASRQLRGQRPGATL----------N-- 49
gi 499965922   6 DISAKQLLDAWRGGDL--------------------AARDQLFTQLYSELRQISAGLIRSER-NLSL----------S-- 52
gi 499435184   9 MGDVTELLCQVRSGDA--------------------KASEGLLRAVYQELRSIAESQFAVEHRERTL----------Q-- 56
gi 499461935   5 STSLTHIIQQWQAGDK--------------------EAESQLYQFAYLQLRKIAQQERERNAEKYGLenevladsvnS-- 62
gi 499874341   1 MSELTELLDHARKGEQ--------------------GARDALMAAAYQELRDMVQRAMSDAASTPSL----------Q-- 48
gi 499966420  25 SIPLVRITASVGRGTAlrrvpflmydqgserppevlAAADRLVPALWEDLRRVARRERRRVGAGQTL----------Q-- 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499353743  58 qvsvcidsTTDIINHLYPRL-G-K-VTSAKLDNRADFYRLIGKVVYSIMKDQSRSKNAQKN-----TLPQEEKQPEYDCN 129
gi 499436207  48 --------PTALVHEAYMRL-VgT-EDHPQWDSRGHFFTAAAEAMRRILIENARRRQSLKRggdrkRFEIAEDDAIIHFD 117
gi 499436060  50 --------SSSLVHQAYVRM-V-D-QDHVDWQGKTHFFAIGATVMRRILVDHARRTQAQKRgggwiRRQLDD-EVTFLLD 117
gi 499433059  61 --------ATALVNEACVRL-L-DtEALKNVSDRRYMFGMANRAMRQILIDHARRRRTNKRggdyqRASLDVVLDNFEAN 130
gi 499965791  50 --------TTLVVHEAWMKL-S-Y-DENRQFVDEDHFLATASRAMRQILVDHVRRKLAEKRgagavHVPIEG-QQVAEPD 117
gi 499965922  53 --------TGDLVNEAVIRL-M-R-VDQIEWADKVHFLALAARAMRRVLIDHARKKRSDKRhh--qKVTLISRLSDGNAD 119
gi 499435184  57 --------PTALVNEAYLRLaS-G-GRLQKFDSRGHFYAAAAEAMRRILIDAARARGSRKRgghcrRLALGEVADDVTPA 126
gi 499461935  63 --------TTALLHDAYLKL-S-T-SDMSEISGKRDFFLMAAKVMRQILIDNARSLQAQKR-------QQVTQLPSEHQE 124
gi 499874341  49 --------PAVLVKEAWLRL-F-S-AGAP-VEARRHFFSAAAQAMRRVMVDRVRLRRAQVRearleRVSLGDVEADVPAG 116
gi 499966420  93 --------TTALVSETWLKL-----RRKENFMDDQHFLRAAALAMRSVLIDHARARLTAKRgagkiDPLTDDIEPFWESD 159
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 499353743 130 IAETMCDLERVYNALVQEKPRAAELLQLNVFAGLNAKKIADMYNISLRTVQNELKFAHAWYHSHFN 195
gi 499436207 118 NAEELLDLNDALTKFERSEPEIAKLVELRYFAGLSVDESAEALGISPRTVKRNWAFARAWLGRELN 183
gi 499436060 118 QDDDVVALDELLLQLASLSPRQARVVELRFFGGLGMKEIAAELNLGLRTVEKEWAMARAWMRRELR 183
gi 499433059 131 NRCQYEDLESALEGLEATSPRQREVVELRFFSGLTNEEVAKVLEISVATVERDWRLARAKLFDQLR 196
gi 499965791 118 AEVQLMDVEAALVRLAQHAPELEQIVECRFFAGYTVNETARILGRPVRSVERDWSRAKTYLAAYLK 183
gi 499965922 120 R-IEMDVLEKALIRLNVIDEEKAEIVELRYFGGMTLEEIAEIRGVSEATIKRNWRAARAWLLDCLN 184
gi 499435184 127 TDLL-LDLDDGLERLFKVDPDSAKLVELRVFAGLSITEAGELMKMSRSTAYRNWEFARTWFAVHWD 191
gi 499461935 125 KFEQLIIMDKALDNFSVRYPRQSNALKLKYLMGMKNQEISELLECSASLIEKDLKFSRSWLQSRMA 190
gi 499874341 117 LSLEVLELDRALSELDTFQPRLARMLELRYFVGLDLLDTAAVLSVSPVTVKRDWAYVREWLLTRLG 182
gi 499966420 160 --ERLLELDDALTRLSKLNPRLAEVVELRFFGGYTEVQAADILGVTDRTIRRDWIKARAWLFRELS 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap