Conserved Protein Domain Family
Sig70-cyanoRpoD

?
TIGR02997: Sig70-cyanoRpoD 
RNA polymerase sigma factor, cyanobacterial RpoD-like family
This family includes a number of closely related sigma-70 (TIGR02937) factors in the cyanobacteria. All appear most closely related to the essential sigma-70 factor RpoD, and some score above trusted to the RpoD C-terminal domain model (TIGR02393).
Statistics
?
PSSM-Id: 274382
View PSSM: TIGR02997
Aligned: 22 rows
Threshold Bit Score: 434.366
Threshold Setting Gi: 499368772
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33640788   11 DLVRSYLRDIGRVPLLSHEQEITLGRQVQ--------------------ELM---------------------SLEQLES 49
gi 33238770   19 DLVRSYLRDIGRVPLLTNEQEITLGRQVQ--------------------ELI---------------------SLEKLER 57
gi 499439516  23 DLVRSYLRDIGRVPLLTHEQEITLGRQVQ--------------------DLM---------------------DIEAMQT 61
gi 499303168  23 DAVSIYLHKIGRVPLLSHEQEIFFAQQVQ--------------------QMM---------------------VMFTAKE 61
gi 499174754   8 DSVRAYLREIGRVPLLTHEEEIVYAKQIQ--------------------QVV---------------------SLNEIKK 46
gi 499303161  13 DIVRNYLQDIVRVPLLTHEEEIVYSKQVQ--------------------QMM---------------------VLQKKKE 51
gi 499308959   7 DLVRIYLQEIGQFPLLTSDQEITYARLVQ--------------------QMI---------------------ALQEQQH 45
gi 499635672   6 DSVGIYLREISKYPMLTPEQEITLARQVK--------------------QMT---------------------VVQQHKQ 44
gi 499563772  42 DLIRLYLQDIGRVRLLGRDEEVSEARWVQ--------------------RYMqllavrncvaveeggvlkdyvDLQEGRD 101
gi 499684785  21 DLLRLYLQDIGRVDLLTNEEEVTLARLVQrreallsqqqklaesdaaigELH---------------------RLEELQR 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33640788   50 ELEGQTGEPAsrkelak-aaglselQLKKK----------------------LQ----------------------SGRR 84
gi 33238770   58 ELESTNGKKPskedlai-dagisvrELSKR----------------------LK----------------------RGVR 92
gi 499439516  62 ELESRDGDKPsrdklak-asgltplQLKRK----------------------LQ----------------------HGRR 96
gi 499303168  62 ELAEKLQREPtlqewad-kmqlkedVLLQQ----------------------LS----------------------QGQI 96
gi 499174754  47 SLAEGKDGEPvspsewakaadlsirELEKA----------------------IK----------------------EGER 82
gi 499303161  52 TLKKQLNHEPsqkelak-yvqlseiEVKDI----------------------FQ----------------------QGTQ 86
gi 499308959  46 ELTQKLEREPttlelan-flnkteaQVNQI----------------------LE----------------------LGQR 80
gi 499635672  45 VLEEQLHQQLniqqlaa-dmgksetEVFQI----------------------LR----------------------LGQK 79
gi 499563772 102 RLTAQLGHRPsfeawak-ivdcsltELRQA----------------------LQlglhrwaevcqldleelkqvckEGQR 158
gi 499684785  80 REANQHSHWPtkqewar-aadlplpELQQRidrgyqawaeqaqleakdlklaLR----------------------NGRR 136
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33640788   85 AKERMVSANLRLVVSVAKKYTKRNMELLDLIQEGTIGLVRGVEKFDPTRGYKFSTYAYWWIRQGITRAIAEKSRTIRLPI 164
gi 33238770   93 AKERMVSANLRLVVSVAKKYTKRNMELLDLIQEGTIGLVRGVEKFDPARGYKFSTYAYWWIRQGITRAIAEKSRIIRLPI 172
gi 499439516  97 AKERMVAANLRLVVSVAKKYTKRNMELLDLIQEGTIGLVRGVEKFDPTRGYKFSTYAYWWIRQGITRAIAEKSRTIRLPI 176
gi 499303168  97 AKQKMIQANLRLVVSIAKKYQKRNLEFLDLIQEGALGLERGVEKFDPTLGYKFSTYAYWWIRQGITRAIAQQSRTIRLPI 176
gi 499174754  83 AKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFDPTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPI 162
gi 499303161  87 AKQKMMVANLRLVVAIAKKYQRRNLELMDLIQEGSLGLERGVEKFDPTRGYKFSTYAYWWISQAMTRAISQQSRTIRLPI 166
gi 499308959  81 AKQKMITANLRLVVSIAKKYQRRNLEFLDLVQEGAIGLQRGIEKFDPNRGYKLSTYAYWWVTQAITRAIAEKSRTVRLPI 160
gi 499635672  80 AKEKMIAANLRLVVAIAKKYRWSQLEFLDLVQEGSIGLQKAVERFDPNRGYKFSTCAYWWIRQEITKAIANKSTTIRTPS 159
gi 499563772 159 AKDHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGITRAIATQSRTIRLPV 238
gi 499684785 137 AKDHMIQANLRLVVAVAKKYQQRGMEILDLVQEGTLGLERAVEKFDPTRGFRFSTYAYWWIRQGITRAIATQSRTIRLPV 216
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33640788  165 HITEMLNKLKKGQRELSQEMGRTPTVSELAEFVELPEEEVKDLMCRARQPMSLEMKVGDGDETELLELL-AGEEELPSEK 243
gi 33238770  173 HITELLNKLKKGQRELSQHLERTPTMQELSAYVEIPVEEVKDLMFRASQPVSLESKVGDGEDTSLLDLL-AIDTDLPDQQ 251
gi 499439516 177 HITEMLNKLKKGQRELSQELGRTPTITELAQYVELPEDDVKDLMCRARQPVSLEMKVGDGDDTELLELL-AGDADLPSDQ 255
gi 499303168 177 HMADKLNKIKCVQRELSQKLGYIAGVTEIAQALNLEPSQIREYLQLVRQPVSLDMRIGFEQDTQLQDLL-KDDGMSPERY 255
gi 499174754 163 HITEKLNKIKKAQRQLSQEKGRAASIAELAEHLELTPKQVREYLERSRHPLSLDLRVGDNQDTELGDLL-EDDGPLPEDF 241
gi 499303161 167 HITEKLNKFKKVQRELSQKLKRSPSADEIAEKMKLNPAQIRELLMISRQPASLDKQVGDNEDTELQELLtEVPETSPEIQ 246
gi 499308959 161 HVNEKLNQIKKVQREFFQTLGRRATVAEIAQKLELEPSQIREYLKVASGTISLDLKIGDNKETELSELL-ASEGVSPDEN 239
gi 499635672 160 HMNDRLIKLKKVQRELVKILGREPNIAEIAEFAELEPNQVRECLIAFRHPLSLDRPMGQEDEVDFLEIL-PADGTSPNEY 238
gi 499563772 239 HVTEKLNRIKKAQRKIAQTKGRTANLEEIAQELEMTPDQVREVLLRVPKSISLETRVGKEKDTELGDLL-ETTDFTPEER 317
gi 499684785 217 HVTEKLNRIKRVQQEIASNEGRIASIADLARELGISEDTVRQTLARVPRSVSLDTRVGREQDTQLGDLI-EDGHATPEQT 295
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 33640788  244 VEVDCMKGDLRTLLEKLPELQGRVLRMRYGIDGGEPMNLTGIAKTLGMSRDRTRRLEREGLALMR 308
gi 33238770  252 IELDCMKGDLEVLLQKLPELQNRVLRMRFGINGEEPMTLTGIGRMLGISRDRVRNLLRDGLKGLR 316
gi 499439516 256 VEEDCMKGDLRSLLGQLPHLQEQVLRMRYGMDGEDPMSLTGIGRILGMSRDRVRNLERDGLAGLR 320
gi 499303168 256 AERELLYQDIHNLLAKLTPQQKEVLILRFGLAGGCELTLVQISQRMGISRERVRQVEKQALTLLR 320
gi 499174754 242 ATYASLQLDLDSLMAELTPQQREVLILRFGLNDGQPLTLASIGSMLSISRERVRQIEREALNKLR 306
gi 499303161 247 VTQNLMRQDIYLSLRELTPQQQQVLILHYGLEDNYELTLTQVAQHLNISERRVRYLEKQALSYLR 311
gi 499308959 240 ITHEMLRQDLSDLLASLKPMQREVLILRFGLLDNQEQSLAQIGEKLNLSRERVRQIQQKAMTALR 304
gi 499635672 239 LDEGFLRQDLANCLITLKPLQKQVLMLRFGLGSVDKLSTKQIAERLNIKQAKVGTTQKQAIKVLH 303
gi 499563772 318 LTQESLSNDLQRLLLELNHRERDVIRMRFGLRDGQIYSLAEIGQVLDLSRERVRQIEAKALQKLR 382
gi 499684785 296 LTHDELHNDLEHLLDELTSREAAVLRRRFGLEDDTPQTLAQIGEELKLSRERVRQIETRALLKLR 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap