2UZ9


Conserved Protein Domain Family
guan_deamin

?
TIGR02967: guan_deamin 
Click on image for an interactive view with Cn3D
guanine deaminase
This model describes guanine deaminase, which hydrolyzes guanine to xanthine and ammonia. Xanthine can then be converted to urate by xanthine dehydrogenase, and urate subsequently degraded. In some bacteria, the guanine deaminase gene is found near the xdhABC genes for xanthine dehydrogenase. Non-homologous forms of guanine deaminase also exist, as well as distantly related forms outside the scope of this model. [Purines, pyrimidines, nucleosides, and nucleotides, Other]
Statistics
?
PSSM-Id: 132012
View PSSM: TIGR02967
Aligned: 22 rows
Threshold Bit Score: 535.682
Threshold Setting Gi: 73536656
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2UZ9_A        48 MEVLRDHLLGV-SDsGKIVFL-EEASQQeklaKE------------WCFKPCEIRELSHHeFFMPGLVDTHIHASQYSFA 113
gi 6330926    51 MEVLRDHLLGV-SDsGKIVFL-EEASQQ----EKla--------keWCFKPCEIRELSHHeFFMPGLVDTHIHASQYSFA 116
gi 17429118   34 YQYWEDGLLVI-GA-GKVVRA-GDHAAL----KG------------TLPAGAQVHDYSGK-LIVPGFIDTHIHFPQTDII 93
gi 76581422   24 LAYDEDGLLIV-EN-GRVVAA-GAHAAL----AA------------RLAPGATLVEMRDK-LIAPGFIDTHVHYPQTEMI 83
gi 58001776   31 LHHEPDGLILT-EN-GLIIAA-GSWDSL----RD------------TIPAGTAVDHYPDM-LISAGMIDTHVHYPQLPVI 90
gi 34101887   25 LVHQRDALVVM-EN-GRIAAW-GPAAEL----LP------------SLRPDVRIDHYPDH-LILPGFIDCHVHYPQTEMM 84
gi 23347144   26 YRYIEDGAVLV-EN-GRILRL-GDYAEV----SG------------EAGADVKLADHRPH-LVVPGFIDTHIHYPQTQVV 85
gi 654538261  26 YRFFEDGAVFV-SK-GKIAGV-GPYGDV----AK------------HVGPSVKIADHRPH-LVMPGFIDTHLHFPQTQAI 85
gi 499282914  26 YAYESDGALLV-EN-GVIKAS-GSYAAV----KA------------AAPEEVPEIDHRPH-LIVPGLIDTHLHFPQMQVM 85
gi 66817198   24 VEILPNSLIGIdED-GVIQHMkSNYEDL----KQlekdvtmictdnGINEQESVIDMGNK-FLIPGFIDTHAHAPQYHNA 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2UZ9_A       114 G-SsIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVC 192
gi 6330926   117 GsS-IDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVC 195
gi 17429118   94 A-S-PSPGLLHWLETYTFPEERRFESPQYAAGVASFFLDELLRNGTTSAMVWSTVHRGSAETLFEQARARGMRLITGKVM 171
gi 76581422   84 A-S-PAPGLLPWLDRYTFPTERRFADPAHARDVAEFFLDTLLACGTTTALVYCTVHKQSADALFGASEARGLRMIAGKVL 161
gi 58001776   91 A-S-YGEQLLEWLENYVFPAEARYADITYARAVARQFLTELLRVGTTTAAVYCTVHPQSVDAFFEESERLNTCMIAGKVL 168
gi 34101887   85 A-A-FGEQLLDWLNHYTFVTEQGFADEGHAREVAQVFLDEQLRNGVTTGCVFGTVHAASVDALFEEAASRDLRILAGKVC 162
gi 23347144   86 A-S-YAANLLEWLNTYTFVAEQKFADEQHAEFIAEHFLDELIRHGTTTAVAYCSVHPQSVDAYFRASQHRNMRMLGGKVM 163
gi 654538261  86 A-S-YGAQLLEWLNTYIFVEEQKFKAPEHAAFIADRFMDELLSNGTTTAAAYCSVHPESVDAFFTAAEERNMLMIGGKVM 163
gi 499282914  86 A-S-YAADLLEWLNTYTFPEECRFVETAHAERIARHFFDEMIRHGTTTATAYCSVHKTSADAFFAESLKRGMCMVAGKVM 163
gi 66817198   98 GtG-TDLPLLKWLEKYTFPVESKFKDLIFAENVYGKVVDRMLRHGTTTCCYYATIHLEASELLAEIVSKRGQRAFIGKVC 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2UZ9_A       193 MD-LNdtFPEY-KETTEESIKETERFVSEMLQKNysRVKPIVTPRFSLSCSETLMGELGNIAKTR-DLHIQSHISENRDE 269
gi 6330926   196 MDlNDt-FPEY-KETTEESIKETERFVSEMLQKNysRVKPIVTPRFSLSCSETLMGELGNIAKTR-DLHIQSHISENRDE 272
gi 17429118  172 MD-RN--CPEYlRDTAERGARDAADLIARWHGKD--RLAYAITPRFAPTSSEAQLAACGELARQHpDVFIQTHVAENPDE 246
gi 76581422  162 MD-RH--CPEFlRDTAQSGYEDSAELIARWHGHG--RQSYALTPRFAPTSTHAQLEACGALARLHpDVFIQSHVAENLDE 236
gi 58001776  169 MD-RN--APENlRDTAQSGYDQSAELIARWHNRG--RQLYAVTPRFAPTSTPEQLDLAGALLATKpDLFMQTHLLENRSE 243
gi 34101887  163 MD-RN--APAAlLDTPLAAYEASRALIERWHGKG--RAEYVITPRFAPTSSHGQLEMLGALAAEFpDIAIQSHISENLDE 237
gi 23347144  164 MD-RN--APPAlCDTAQSGYDDTKALIARWQGQG--RLDYVITPRFAITSTPEQLEASQTLVREHpECFVQTHLSENHDE 238
gi 654538261 164 MD-RN--APDAlRDTPEKGYDETKALIAKWHGRG--RAHYAISPRFAITSTPEQMEVSRVLAAEHpDCYVQTHLSENRDE 238
gi 499282914 164 MD-RN--APQGlLDTPEMSYDETRAVIADWHGKG--RNHVAITPRFAITSTPEQMEVAKSLVGEFpDLHVQTHLSENRDE 238
gi 66817198  177 MD-RH--SPDHyVETTEQSISNTKEFVDRILAKGnpLVQPIVTPRFAPSCTDELMVALGNLSHEK-QTLIQSHLSENKDE 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2UZ9_A       270 VEAVKNLYPSYKNYtsVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVL--EV--LKHEV 345
gi 6330926   273 VEAVKNLYPSYKNYtsVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVL--EV--LKHEV 348
gi 17429118  247 VKWVAELFPNARSYldVYDRYGLLRRGALYGHAIWLDDGDRRRMAESGAAVAHCPTSNLFLGSGLYNFH--AS--DAHRL 322
gi 76581422  237 LRWAAELFPERRSYldVYDHYGLLRRRAVYGHCIHLDDDDRRRFAETGAIAAHCPTSNLFLGSGLFDFE--RA--NARHM 312
gi 58001776  244 IAWVRELFPDRTSYldVYDKAGLLRPRAILAHAVHAEEADFQRCHHTGCSIAHCPGSNQFLGSGSFPLF--KAlnPERRV 321
gi 34101887  238 IAWVKQLFPGCRDYagVYQRYGLLRRRAIYGHGIHLSEAELEMLHDSGASLAHCPTSNFFLGSGSLDLR--RCveGGKPV 315
gi 23347144  239 IAFTRSLYPDAPDYlgIYEHYSLLGNKTLLGHSIHLEEREVRLMAETGSIAVFCPTSNLFLGSGLFDRD--RL--KAAGV 314
gi 654538261 239 IAFATSLYPEAKDYtdIYARYELLGRKTLLGHCIHLSDREISVLAKTGAVGVFCPTSNLFLGSGLFDRD--RF--DRLGA 314
gi 499282914 239 IAYTSELYPEATDYtdVYARYGLLGPKSLFGHCIHLSEREADAMSETGSVAVFCPTSNLFLGSGLFPLRglKR--RQKPV 316
gi 66817198  253 IEWVKSLYPGIESYthVYKHFNLLNERTIMAHCVHLSDEEIKLISTQQTAISHCPISNFTLSSGNLDVR--KV--LEANI 328
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2UZ9_A       346 KIGLGTDVAGGYSYSMLDAIRRAVMVSNILlinkvnEKSLTLKEVFRLATLGGSQALGLdgEIGNFEVGKEFDAILINPK 425
gi 6330926   349 KIGLGTDVAGGYSYSMLDAIRRAVMVSNILlinkvnEKSLTLKEVFRLATLGGSQALGLdgEIGNFEVGKEFDAILINPK 428
gi 17429118  323 ALTLATDVGGGSSFSMLRTMGAAHEVARMG------GYHLSALRLFYLATRGAAEALGWqdRIGSFVPGAEADFIVLDPA 396
gi 76581422  313 AVTLATDVGGGTSFSMLQTMNEAHKIARMT------GHHLSATRMFWLATAGAAHALDLadTIGTLAPHAEADFVVLDPA 386
gi 58001776  322 HVGIGSDIGAGPSLSLLQVLSDAYKVAQGL------QTKLHPAQGLWLATAGGAQSLGLedRIGSIRPGLYADLCVFDPA 395
gi 34101887  316 RLGLGTDLGAGTSFSMLQTMNAAYMASQTH------GRPLTAAQAFYLATRGGAEALGIedKVGSIEAGMEADLAVLDLR 389
gi 23347144  315 RMAVATDIGGGTSFSMLRTMDEGYKVLQLR------GQRLNPFQSFYMMTLGNARALSMedRIGTLEEGTEADIVVLDSS 388
gi 654538261 315 RHAVATDVGGGTSFSMLETMDEAYKVLHLQ------GQRLSPLNSFYMLTLGNARALDLehRIGSLHAGADADIVVLDSR 388
gi 499282914 317 RVSVASDIGGGTSYSMLKTLDEAYKILQLQ------GERLNPFDSFYMMTRGNAEALSLadRIGTLEPGTDADIAVLDMA 390
gi 66817198  329 KLGLGSDISGGYHPSILQVIRDSIKCSNSHffnngnHTPLTFEEAFYLATVGGSKVVNLdhRIGNFIVGKDFDAQIIDPF 408
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|.
2UZ9_A       426 ASDSPIDLFYGdffGDISEAVIQKFLYLGDDRNIEEVYVGG 466
gi 6330926   429 ASDSPIDLFYGdffGDISEAVIQKFLYLGDDRNIEEVYVGG 469
gi 17429118  397 ATPLLARRNSR---AETLEAQLFSLALLGEDRAVAATYIQG 434
gi 76581422  387 ATPLLARRTAR---AESLEELLFALALLGDDRAVYRTYAAG 424
gi 58001776  396 ATPLGRIRAQT---AETLADRLFALTMLGDDRSIAATYVAG 433
gi 34101887  390 STPLLDFRMRY---VRDLSEALFVQMMLGDDRAVAATYAAG 427
gi 23347144  389 ATSPMRLRMAA---GATLEQELFLLQTLGDDRAIVETYVAG 426
gi 654538261 389 AKPAMELRMQV---ASTLAEELFVLQTMGDDRSVAEVYVAG 426
gi 499282914 391 ATPAMALRAEV---VNSLADELFLLQTMGDDRAVVETYVAG 428
gi 66817198  409 VQNSPFDCFDG----ETLKDIFQKFIYLGDDRNLSSLYIKG 445
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap