Conserved Protein Domain Family
SigZ

?
TIGR02959: SigZ 
RNA polymerase sigma factor, SigZ family
This family of RNA polymerase sigma factors is a member of the Sigma-70 subfamily (TIGR02937). One of these is designated as SigZ in B. subtilis (Swiss_Prot: SIGZ_BACSU). Interestingly, this group has a very sporatic distribution, B. subtilis, for instance, being the only sequenced strain of Bacilli with a member. Dechloromonas aromatica RCB appears to have two of these sigma factors. A member appears on a plasmid found in Photobacterium profundum SS9 and Vibrio fischeri ES114 (where a second one is chromosomally encoded).
Statistics
?
PSSM-Id: 132004
View PSSM: TIGR02959
Aligned: 7 rows
Threshold Bit Score: 254.213
Threshold Setting Gi: 32444597
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3024616    7 WDQFHQPLKTYISHRVNDQSIVDDLLQIVFMKIQVHLPNLIDEQKIDSWIYRITRNTIIDFYRTKKTSEILPDVLHFNDS 86
gi 77994910  12 SKEFYQLLKNFIKKQVSQESDVEDILQEVMIKIYKNIDKLNDSSKLQSWIYQIAKNTIIDYYRKQSKSIFLHDNLVFYSS 91
gi 78195243  32 WQEYHLRLRAFIKSRIADDAVADDTLQNVFLKMHAGLPSLKDGTKLQSWLYQIARNAIIDLYRSQKASTGIPVSLAHPES 111
gi 32444597  29 WNLFGEELRTFLLRRVSAAQVAEDLLQETFVRIHTKLNEVDDQQRIRSWVFQIARNLVVDHYRSKSREAAALADEIAANG 108
gi 59479680   5 WQNHKAQLRNYVYKRVDDASAVDDILQDVYIKASSNLHQLKSKGSLKGWLYKIAYNTIMDFYRDKLPYDELPEDLVAEDE 84
gi 46915351   7 WSAYRSQLKAFLHSKVSNSADVEDLLQEILIKTHNSLGSLQKGDSIQSWLFQIANRTTIDFYREKGRTKELEAEELWF-G 85
gi 71848184   8 WDEHRSELLHFVANRIPDLQEANDVVQEVFLRATRLERGLCGIANRRAWLFQVARNLLIDRYRLTRYEVVLDESQLTAVD 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3024616   87 AEEENFTKEATVCIRSTIKRLPEKYREALELTDFQGLSQKELSEKLGISYSGAKSRVQRGRGKLKQLLEGCCHIEADRYG 166
gi 77994910  92 PVESTFNKEIAQCLKNMIDHLPDPYRQAILLTEYHGFTQKKVSEKLGLSVSGVKSRVQRARKMLKNMLENCCYLEFDRLG 171
gi 78195243 112 NPGEKAVQELSDCLQPMIQRLPEIYREAIILSELEGLTQREVAEVLGTSLSGAKSRVQRGRALLKGMIADCCRLELDHNG 191
gi 32444597 109 EREESLEDVVIGWLPKMLAQLPEEQREAVELYEIQGLSQQEIANKLGLSLSGAKSRVQRGRSKLKQVLFDCCSFEHDRRG 188
gi 59479680  85 DAVEESRKEIAECMRPLIDELPDKYSVPLRLAELDGIPQQEIADKLGLSLSGAKSRIQRGRVKFRENLMTCCDFEINDGG 164
gi 46915351  86 KREENIKADLSPCIEPFLKALPDDMAHLLRAIDLEGQSPKAYAQELGLSYTTLKSRVKKGRTALRGLFEGCCHYSLDQHG 165
gi 71848184  88 AEPITPVDSLSQCIPRVLTELSVEDREAITLCDIEGISQQDFADRIGVTLPAAKSRVQRARKRLREQLVTACQVRFDEVG 167
                       170
                ....*....|
gi 3024616  167 NIVDFRILKE 176
gi 77994910 172 NIIDYQHKDT 181
gi 78195243 192 RLCDYERKGK 201
gi 32444597 189 NLIGYERNHS 198
gi 59479680 165 MVTGYTPKKT 174
gi 46915351 166 SLIDFDQKSN 175
gi 71848184 168 QVCCFVPRGP 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap