Conserved Protein Domain Family
SigW_bacill

?
TIGR02948: SigW_bacill 
RNA polymerase sigma-W factor
This sigma factor is restricted to certain lineages of the order Bacillales.
Statistics
?
PSSM-Id: 131993
View PSSM: TIGR02948
Aligned: 3 rows
Threshold Bit Score: 338.407
Threshold Setting Gi: 10172875
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56378527   1 MDLFIKKRIKAIQKGDQNAYADLVDLYKDKIYRLCYRMLGNRHEAEDAAQEAFIRAYIHIDTYNPEMKFSTWLYRIATNL 80
gi 52001876   1 METMIKKRIKQVKKGDRNAFADIVDIYKDKIYQLCYRMLGNAHEAEDIAQEAFIRAYVNIDSFDINRKFSTWLYRIATNL 80
gi 10172875   1 MDSIDKRLVREVRAGDEQAFAELVELYKDKVYQVAYRMVGNVHEAQDVAQEAFLRAYTNIDTYDIQRKFSTWLFRIATNV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56378527  81 TIDKLRKRKPDVYLDEEVGGTDGLTMQAQLPSREASPEEAVESLELQETVQRAIEQLPEKYRSVIVLKYMEDLSLQEISE 160
gi 52001876  81 TIDRIRKKKPDYYLDAEVAGTEGLTMYSQVAADVALPEDEVVSLELHSTIQEKILRLPDKYRTVIVLKYIDELSLIEISE 160
gi 10172875  81 AIDRLRKRKPDFHLEDPVQGADGLTIESQLAADEEPVDDQVIQMETRDWIQQEIQALPPKYRMAVLLKYMEDLSLKEISD 160
                       170       180
                ....*....|....*....|....*..
gi 56378527 161 ILGLPVGTVKTRLHRGREALRRQLGHL 187
gi 52001876 161 ILNIPVGTVKTRIHRGREALRKQLRDL 187
gi 10172875 161 ILDLPVSTVKTRIHRGREALRKRMRHV 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap