Conserved Protein Domain Family
SigH_actino

?
TIGR02947: SigH_actino 
RNA polymerase sigma-70 factor, TIGR02947 family
This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building, bidirectional best hits and (with the exception of a paralog in Thermobifida fusca YX) one-to-a-genome distribution, to represent a conserved family. This family is restricted to the Actinobacteria and each gene examined is followed by an anti-sigma factor in an apparent operon.
Statistics
?
PSSM-Id: 131992
View PSSM: TIGR02947
Aligned: 3 rows
Threshold Bit Score: 368.531
Threshold Setting Gi: 50840347
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50840347   13 VAEETKTQRAQRFERDALEYLDQLYGAALRMTRNPADAEDVVQEAYAKAFSSFHQFRPGTNLKAWLYRILTNTYINSYRK 92
gi 54018065   20 GTPVDEAELAQRFERDALPLLDQLYGAALRMTRNPADAEDLVQETYVKAFQGFKSFKEGTNLRAWLYRILTNTYINSYRK 99
gi 500011774  54 VVSETSEQRRLRFERDAMQYVDQLYSAAMRMARNPADAEDLVQEAYTKAFSAFHQYKPGTNLKAWLYRILTNTYINLYRK 133
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50840347   93 AQRRPQTSDDQDVEDWQIAKAASHDSNGLRSAELEALDGLPDQQILDALDGLSDEFRQVVLLADVEGFAYKEIAEIMGTP 172
gi 54018065  100 KQRQPAQYPTDEITDWQLAATAEHTSTGLRSAEVEALDALPDDDIKAALQELPEEFRMAVYYADVEGFPYKEIAEIMGTP 179
gi 500011774 134 RQREPLQSNSDTIEDWQLARAESHTSSGLRSAEAEALDHLPDSDVKRALQAIPEEFRLAVYFADVEGFAYKEISDIMNTP 213
                        170       180       190
                 ....*....|....*....|....*....|...
gi 50840347  173 MGTVMSRLNRARKQLRKQLVDVAGARGIGPRAG 205
gi 54018065  180 IGTVMSRLHRGRKQLKGLLADVARERGFNRSER 212
gi 500011774 214 IGTVMSRLHRGRKMLRDMLGDYAAERGFKAATE 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap