Conserved Protein Domain Family
TIGR02928

?
TIGR02928: TIGR02928 
orc1/cdc6 family replication initiation protein
Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 274354
View PSSM: TIGR02928
Aligned: 20 rows
Threshold Bit Score: 370.81
Threshold Setting Gi: 23396500
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10584314  63 VFVNRDLVEPDTIIDeeRIVGRDEQLESVVSFLKPTLQGNRPPNMLLYGPAGTGKSLIIGAVTQQIIELCHSKGERFGVV 142
gi 23396487  13 IFKNRDVLRHSYTPE--KLPHREEQINQLALLLSPMLRGGTPSNIFIYGKTGTGKTATVLFVARQLEEASRKAKLNVAVH 90
gi 62286609  28 IFEKPWLLEIDNVPDanRIVGRDDHITFLAKNLRKMRTNSVPDNVLEWGETGTGKTLVARHVCERLEAATEGTDSPIVTA 107
gi 23396513  21 IFANKDLLKIGHVPEadRIVGRDEEISKLAKRLNGAVHGYSPENVMIYGKTGTGKSLVSKHVCQRAQNAAQD-GVEIGTA 99
gi 31563008  20 IFKNKEVLRPSYTPD--LLLHRNDQINSLATILVSALRGETPSNVLIYGKTGTGKTAVTRYVGKELERVSEDKSIFCSVV 97
gi 31563007  13 LFKDLSVLEPDYLPE--YFPHRDSQLNALRFALKPALRGMRPLNCLLVGPPGTGKTSAIMKTFREVEAHAPN----VVTV 86
gi 23396484  13 VFKDKKYLDHRFLPD--RLPHREEQIRSIAKYWVEALNGVTPPDITIYGKTGTGKTAVAKFAMKQLKEASKDCDVNIRTE 90
gi 59797765  15 IIGNLKTLSSSYIPD--NLPHREQQIELMARSLSSIMHGGIASNILLYGQSGSGKTSSAINVTNMLRSAAGDR---VSIH 89
gi 14324985  39 IQADLSLLEENYIPD--SFPHREKQINDMVTILSSIMRNSRPSNIIVYGKTGTGKTSTTKYVTRMLQEATSN----VEVI 112
gi 23396501  17 IFRNRELLLPDYVPE--ELPHREEQIKRLVEILSPLMRGEKPNNIFIYGLTGTGKTAVTKFVVKKLHEKISNS---FIYV 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10584314 143 QVNCQPINTLDQAVYELVQTVasdvgiEPGVPETGVSTKRK---YRRLYDLIN-EHYDSVIFILDEIDLLVgrRANDEpa 218
gi 23396487  91 YINCEIVDTAYRVLASLARKF------GSNVPMTGWPTDQV---YEEVKKALE-RRGTRVVVILDEIDKLV--KKAEE-- 156
gi 62286609 108 YINPDPISTYTSTFRKIAEQVnakaenPLEVPYQGLSAEHYr--DQKLWPVVQrEFSGGLVVIIDEIDKH---GEVNE-- 180
gi 23396513 100 YIDCAEDNTETQAISSLAAKLndesstGISVPHTGLSTSKY---YKLLWKTLD-AQFDSVIIILDEIDLM----NDDS-- 169
gi 31563008  98 YINCEVIDTQYRLLANLARHF------EEEVPMTGWPTDQV---FMKFKEAID-SREQVIIIILDEIDKLI--KKGDD-- 163
gi 31563007  87 KVNCQIDSTRFAVMSRIYRQLf-----GISPPNSGIAFRKL---FETVVNFLV-SSEKVLIVALDDLNYLCceGHANE-- 155
gi 23396484  91 YIRCTDYTTEYQVIARLCQQL------GRDVPYRGWTKAEIvntFRNMFKKNAfGQDMILMVVLDEIDILLr-NDGDG-- 161
gi 59797765  90 YINCEIYDSHYSIMVHMVNSFi----gEEQIPNLGLPFDRI---YYELVKRIK-SRNLYTLIILDEIDRLLs-KNGSD-- 158
gi 14324985 113 YVNCEIYDSPYSILVYVANFAg-----GEKIPELGWPVDRI---YREAVDRIN-GTGKFFVIVLDEMDRLIk-KSGGD-- 180
gi 23396501  92 YINTRQTDTPYRILADLLENL------GSKVPFTGISTAEL---YRRFIKKVL-ELKPILVIVLDEIDALVk-KHGDD-- 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10584314 219 yskLLYQLSRAsnTNDIE-GQVSVAALTNDPKFMENIDGRAESSFNPRDIYFPDYDATQLRQILENRRD-AFRQDALTDD 296
gi 23396487 157 ---ALYGLTRI--NSELEnSSICIVGISNNLKFKEYLDARILSSLSEEEIVFPPYNAEQLEDILQQRAKlAFEDGVLEDG 231
gi 62286609 181 ---VLYTLSRTqsKDDVD-FPVITIGISNDIEFKGEIESRVQSTLQPEHRTFTPYEEDQLIAILENRRD-AFYDGVLDDE 255
gi 23396513 170 ---VLMKLSRAeeAGKID-CSVGVIAISNKIQYVDNVNERVKSSFQHKELFFKPYDANQLREIMFNRED-AFQDGVLSED 244
gi 31563008 164 ---VLYNLSRI--NTDLRkAKVSMIGVSNDLKFTEFLDPRVKSSLGEEELIFPPYDAEQISDILKQRAKmAYNDGVLGEM 238
gi 31563007 156 ---VMYSLLRA--HEQYPgAKIGVIGIVNDASDLYCLDSRVNSVFLPEEVSFPRYEEGEILDILKDRVRyGFYPKVISDE 230
gi 23396484 162 ---LLYTLTRT--------DNVSILSISNYVEFKKFIKPRVRSSLRDREIVFPPYGAQQLVDILEERSKmSFKEGALDDD 230
gi 59797765 159 ---SLYVILKL--LGDTEg---SIIGITNDSSFINKLDMRVRSRLNAESIIFTPYNADELRDILKFRINgVIKNGFIEDS 230
gi 14324985 181 ---SLYVLLKL--MTDVEnVKVSMIGITNDTTLLENLDSRIKSRLNQESIVFPPYNATEIRDIIASRLEkVFGPGVVDDT 255
gi 23396501 159 ---ILYRLTRA--NYEMGkSKVSIIGITNDIKFVEFLDPRVKSSLSEEEIVFPPYNAEELEDILKRRATlAFYDSVVSDD 233
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10584314 297 VLPLVSAFAAQSHGDARKAIDLFRGAGDLADEQGDQTVREDHVRESQDEIDKDRSLKLIAGLTTQKKISLYATAAVAHcs 376
gi 23396487 232 VIQLCAAIAAQEHGDARKALDLLRVSAEIAERERDSMVRVEHVKKAVRKIETDYMIETVRTLPVHSKILLYSMSLISE-- 309
gi 62286609 256 VIPTTAELAAEEHGDARRAVRLFRNAGEIADEEGDDIVTAEHVHEADELVEVELFMEMVKGTPLSGKLLLFALTRLDRnn 335
gi 23396513 245 VIPLSAAFAAQEHGDARKAIDILRHAGEVAYEAGAELVTEEHVRQAQQHAEKDRFRELVNGAPTQAKAALLALTELSVn- 323
gi 31563008 239 VIPLCAAFAAQEHGDARRALDLLRVSGEIAERENQPQVLEEHVRRAQEKIEIDRVVEVVRTLPTQSKLVLYSIILLRNrg 318
gi 31563007 231 VLKLVVSYVEKT-GDLRVGIDLLRRSGFNAERKGRRMILFEDVEKAYEASKLLHLCRGISLLSDPEKQLLELIA------ 303
gi 23396484 231 VIPLCAALAAKEEGDARYALDLLRTAGEIADERDSDKVLGDFVREAKDYIEHNKITDIILTLPSQQQRVLEAILYLTK-- 308
gi 59797765 231 AINLCAAIGAQEHGDARKAIELLRIAIEYCIRENRERVTIDDIYMARERFEMNILKESVKTLPIHSKMVLLSAILTQEv- 309
gi 14324985 256 AINLCAAIGAQEHGDARKAIDLMRIAIEIAIRENRLKVTEKEVYEARDKYEMNVMHEAINTLPIHSKIVLLSAIVTQEi- 334
gi 23396501 234 VIKLCAAIAARDHGDARRALDLLRVAGEVAERDGAEKLTIEHVNKARVEIERDRVYEVVSTLPFHSKLVLLAIVIGVNe- 312
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 10584314 377 saTRNSVPSPVGFQVYQWVTEEIDADQMTRETYVKYVKELSTYGLVSTARKSRGRgGGMYMDFTF 441
gi 23396487 310 --NSPKFTTGEVYCVYKKLCGKVGVDPLTQRRISDLISELDMLGILNSVVISKGR-YGRTREMKL 371
gi 62286609 336 -pEKEWFRTSEIHEVYQTVARDVKVEPKGYNRALELLNKHVTTGVLESKKKEGGD-QGKFRSYSL 398
gi 23396513 324 -sNDDAFLTSRVYDQYEHICNHLDMDILSVRRFRDILKEQAFLGVVEIEKINKGSaGGIHLQNRL 387
gi 31563008 319 -rEGKNVTTGEMYNVYRQLCHHIDVDILTQRRVTDLMSELDMLGIVNAVVVSKGR-YGRTKEISL 381
gi 31563007 304 --KKDEIKAGELYKSFHELTQ------LGYTRFYGMVNRLQTLNYVDADFTGKGK-RGRTRIIKT 359
gi 23396484 309 --RKEEITSGRLYEVYKEIAKG---DSVSYRRIFDFINELEMLGLISTNTVSRGRgKGRTNIIDL 368
gi 59797765 310 --SSDIAVTGEIYENYKNICAEIGLQPLSTRRISDLMSSLDDLGLIVTTTRSMGR-YGRTKLIKV 371
gi 14324985 335 --EPNSVITGEIYENYRRICEDLGFTPLTPRRISDLLTELSDYGLIVVDERNMGK-YGRTRGFSV 396
gi 23396501 313 --KRRTLTTGEVYDVYTKLAKKIGVESVTQRRVSDIINELDMLGIITARVVNRGR-YGKTKEVNL 374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap