Conserved Protein Domain Family
spore_sigI

?
TIGR02895: spore_sigI 
RNA polymerase sigma-I factor
Members of this sigma factor protein family are strictly limited to endospore-forming species in the Firmicutes lineage of bacteria, but are not universally present among such species. Sigma-I was shown to be induced by heat shock () in Bacillus subtilis and is suggested by its phylogenetic profile to be connected to the program of sporulation (). [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131941
View PSSM: TIGR02895
Aligned: 6 rows
Threshold Bit Score: 268.169
Threshold Setting Gi: 20515095
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56379309  17 VVEIQRGNEAlRNELIRQYKPFIVKTVSSVCKRFI-REEDDEASIGLIAFNEAIEKYALHKGGSFLSFAELLIKRRLIDY 95
gi 47551870  18 VCNIQNNEED-KEAFIVQYQPFIRKSISSVCRRYI-TEQDDEYSIGLFAFNEAIEQYSYKKGKSFLAFADLLIKRDVIDY 95
gi 22776783  15 VYAIQQGNKFlQNELLRTYQPFIAKCVSEVCKRYIdPKRDDEFSIGLSAFNEAIFSYVPNKGSSFLSFAKLVIKRKVIDY 94
gi 20515095  10 VYIAKKDPSE-REKLIEEYTPFIIKQVSHFANKYIdEQNSDELSIGLIAFNEAIDSFDITKGS-FLNFSSLIIKRRIIDF 87
gi 15024740  11 IQKAKESKEE-LNRLIQEYKPFIASLLQKKTGKYLqYGYDDELSIGMIAFEEAVESYDRNKGK-FLSFAKRVIILRAIDY 88
gi 77995838   1 MQPNNPINDEiFEQMIRQHESLIFGIAARLTGRFI-TKSDDEYSIGLLALSEAIQSYNSAKGVEFEKFAAQIIRRRLIDF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56379309  96 IRKEVRTrEAIWHVEDEEngeqaaQTYVDAKLSVEEFYRQIEQEQRREEILHYQQVLKQFGIHFHDLVEQSPKHKDARLN 175
gi 47551870  96 IRKESKH-NLVFLKEDEQ------EEMLEMQVSLTEYMKEIENGNRKEEILHFQSVLADFKITFSELAKESPKHRDTREH 168
gi 22776783  95 IRYQQKRtASLSLDETYDee--qmENSLEIAAVQEKYQMEIDAQNRKEEILEFKEKLKLYKLSLVELTEVSPKHRDARES 172
gi 20515095  88 LRQNQ---DLAYPLDVYP-----------------ERESDYEIENRRLEMLSFVNLLSLYGIEIEDLVRQSPKHRETRKL 147
gi 15024740  89 YRKNQKFkNIVYLQGNYDsen-ndINPIMFNKAMEQYKNKSINEIRRLEILEYKKELREWGIEFVNLVQASPKQEKLKKT 167
gi 77995838  80 YRQNKSYqQNLPLDESFL-----------------SQRNLIDEVDVRLEIAEYEKLLKQFNITFAELVKVSPKHNDSRQK 142
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 56379309 176 AIRVAELLVANDEWLGILFRKKQLPIKQLETMASVSRKTIERNRKYIIAVAVILAGDYIYLKDYI 240
gi 47551870 169 LIEIVKVIIKEEEMMEELFRKKKLPLKHIEPRVRVSRKTLERHRKYIIAMCIIFANNYTYILDYI 233
gi 22776783 173 AVKTARILFNDPILREYVYRKKKLPIKDLVKKVDVSKKTLERNRKFILAMFIVLSEDYIYLKEYL 237
gi 20515095 148 ALKIARTICENEHLLSYLKKTKTLPVKELIELLRISRKSIEKYRKYIIALVIILSEDLPILKEYI 212
gi 15024740 168 YKNIANVIVHNQDILNKLIRVKRLPIKEIEKNIYINRKKLERGRIYIIALVIAEIGDYRLIREYI 232
gi 77995838 143 LIMLAKGIAEDEEFVRQLIRTKKLPLQSISERFKIKQKTIEKYRKYLVAIILIYWGRFTGLQAYL 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap