Conserved Protein Domain Family
spore_sigG

?
TIGR02850: spore_sigG 
RNA polymerase sigma-G factor
Members of this family comprise the Firmicutes lineage endospore formation-specific sigma factor SigG. It is also desginated stage III sporulation protein G (SpoIIIG). This protein is rather closely related to sigma-F (SpoIIAC), another sporulation sigma factor. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131897
View PSSM: TIGR02850
Aligned: 7 rows
Threshold Bit Score: 482.022
Threshold Setting Gi: 1350864
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10175174   4 NKVEICGVDTSKLPVLKNQEMRELFARLQ-SGDTSARETLVNGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKSIDNF 82
gi 51975054  34 NKVEICGVDTAKLPVLKNDEMRKLFREMQ-SGEISAREKLVNGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKSIDNF 112
gi 22777159   4 HKVEICGVDTSKLPVLKNEEMKKLFVRMQeDGDITAREELVNGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKSIDNF 83
gi 77996047   4 NKVEICGVNTSKLPVLTNQEMKKLFLKVK-EGDMEARQKLISGNLRLVLSIIQRFTNRGEYVDDLFQVGCIGLIKAIDNF 82
gi 51856049   3 NKVEIPGVNTAKLPVLTNAQMRELFVRMR-SGEKAARDELITGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKAIDNF 81
gi 1350864    4 NKVEICGVNTSKLPVLKEKEMRELLISMR-NGNTTAREKFIKGNLRLVLSVIQRFNNRGENADDLFQVGCIGLIKSIDNF 82
gi 20516644  11 NKVEISGVNTSKLPVLKPSKQRELLIRMK-NGDKKAREEFINSNLRLVLSVIQRFNNRGESVDDLFQVGCIGLIKAIDNF 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10175174  83 DLSQNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVRDQLMGEKQreKEPTVQEIAKELGVPKEDVVFAL 162
gi 51975054 113 DLGQNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVREKLIAENS--KEPTAMDIAKVLEVTHEEIVFAL 190
gi 22777159  84 DLSHNVRFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVREKLISKTS--KEPSPAEIAKEMDIPQTDVVFAL 161
gi 77996047  83 DLEQNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDVAYKALQVRDNLVGRFS--REPTVSEIAQELKVPQEEVVFAL 160
gi 51856049  82 DLGQNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVRDALVNRLS--REPTVQEIADELGLPLEEIVYAL 159
gi 1350864   83 DLSQNVKFSTYAVPMIIGEIRRYLRDNNSIRVSRSLRDIAYRALQVRDRLISKNN--KEPTVSQIAKELKIPREEVIFAL 160
gi 20516644  90 DLDQNVKFSTYAVPMIIGEIRRYLRDNTPIRVSRSLRDIAYKALQVRDKLVSENS--KEPTVGEIAKELDLPSEEVVMAL 167
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10175174 163 DAIQDPVSLFEPIYNDGGDPIYVMDQISDDRNKDVQWVDEIALKEAMVRLNDREKLILNMRFYQGKTQMEVAEEIGISQA 242
gi 51975054 191 DAIQDPVSLFEPIYNDGGDPIFVMDQLSDEKQKDEQWVEELALKEGMKRLNDREKMIIRKRFFQGKTQMEVAEEIGISQA 270
gi 22777159 162 DAIQDPVSLFEPIYNDGGDPIFVMDQISDEKDKDSSWVDKLSLKEGMHQLNEREKMILNKRFFQGKTQMEVADEIGISQA 241
gi 77996047 161 DAIQDPVSLFEPIYQDGGDPIFVMDQIKDEKNTDHNWLQGIALKEALERLNERERLILKLRFYEGKTQMEVAEEIGISQA 240
gi 51856049 160 DSIQEPVSLFEPLYNDGGDPIYVMDQVSDESQQDSQWLEGISIRQALHRLNERERLILTLRFFEGKTQMEVAEEIGISQA 239
gi 1350864  161 DAIQDPISLFEPIYHDDGDAIYVMDQISDNKNLDDSWLQNISIKEAMKKLSDREKMILNMRFFDGRTQMEVADEIGISQA 240
gi 20516644 168 DAIQEPVSLFEPIYHDGGDAIYVMDQVSDDKNVDEVWLEKIALKEALEKLNEREKMILTMRFFEGKTQMEVAKEIGISQA 247
                       250
                ....*....|....*..
gi 10175174 243 QVSRLEKAAIQQMSKHA 259
gi 51975054 271 QVSRLEKSAIKQMNKTI 287
gi 22777159 242 QVSRLEKAAISQMNKQM 258
gi 77996047 241 QVSRLEKAALNHLRKFV 257
gi 51856049 240 QVSRLEKAALSHMRKYV 256
gi 1350864  241 QVSRLEKTALKHMKKYV 257
gi 20516644 248 QVSRLEKAALNHMRKYI 264
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap