3LM6


Conserved Protein Domain Family
spore_V_AD

?
TIGR02845: spore_V_AD 
Click on image for an interactive view with Cn3D
stage V sporulation protein AD
Bacillus and Clostridium species contain about 10 % dipicolinic acid (pyridine-2,6-dicarboxylic acid) by weight. This protein family, SpoVAD, belongs to the spoVA operon that is suggested to act in the transport of dipicolinic acid (DPA) from the mother cell, where DPA is synthesized, to the forespore, a process essential to sporulation. Members of this protein family are found, so far, in exactly those species believed capable of endospore formation. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 188254
View PSSM: TIGR02845
Aligned: 10 rows
Threshold Bit Score: 559.695
Threshold Setting Gi: 56909805
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LM6_A           6 KQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEXHCNQKSWEXAERQLXEDAVNVALQKNNLTKD--DIDLLLAG 83  Bacillus subt...
AAK80260         7 SQTARIDSKPRIVSAVSMVGPKEGRGPLKDYFDIILSDDMNGEESFEKAESNMLYTVITEVIKKSNLTEN--DIDYLFAG 84  Clostridium a...
AAM24544         8 AQTVKFKNPPSIIAGGTIVGPKEGEGPLRDYFDMILIDDTYGEKSWEKAESKMFQDAVNLALKKANLKIS--DIDYLLGG 85  Caldanaerobac...
tigr:CHY_1956    2 RQTREFANPPVVLGYATIAGPKEGEGPLATYFDKIINNLYYYEDTWEKAEQKMFLEVVEMALQKASVKKE--EVDFFLAG 79  Carboxydother...
P40869           6 KQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEMHCNQKSWEMAERQLMEDAVNVALQKNNLTKD--DIDLLLAG 83  Bacillus subt...
BAD76589         6 KQTWVFDDGVYIQAAAAAVGPLEADGPLGSYFDVCHRDLYCGEATWELAERRLMREAVDCCLQKAGVSAE--EVDLFLAG 83  Geobacillus k...
BAB05259         6 KQTLKFDKPVYIESTGTAVGPMEGAGPLRHTFDQAYDNLYCGEDSWELAERRLMQDAIEHCLKKVHVETE--RVSFMIAG 83  Bacillus halo...
BAD64332         5 HRTMTFSNPVYIQSSGTAVGPKEGAGPLAGSFDYRYTDIYCDEKSWEMAERALMKQAIKQCLTKNHLSID--SVDLFVAG 82  Bacillus clau...
tigr:GBAA_5376   5 HRTWVFENKPVIISTGVVGGPFEAKGKIPEDFDTLHEDLWLGQDSYEKAHKILFEEACSRATEKANLRKD--DIQFVLAG 82  Bacillus anth...
BAD39188         8 AQTVRLEQPPVIVGAAAVAGPVEAQGPLGHEFDLTYPDLTVGQDSFEKAERQMMIDACNLALRRAGIQQKppAVDYFLAG 87  Symbiobacteri...
3LM6_A          84 DLLNQNVTANYVARHLKIPFLCXFGACSTSXETVAVASALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTATS 163 Bacillus subt...
AAK80260        85 DLLNQITSSSFAARDAKIPFYGLYGACSTMTESLSIAAMIMDGGFADYTIAATSSHFSAAERQFRYPLEYGSQRKPDAQW 164 Clostridium a...
AAM24544        86 DLLNQIISANFAARQLNVPHFGLYGACSTMTEGLTLGAMLIDGGYADYVIAATSSHFSTAERQFRYPLEQGIQRPFTSQW 165 Caldanaerobac...
tigr:CHY_1956   80 DLLNQIISANFVAKSLGIPFFGLYNACATFYEGLILGAMLIAGGFAKKVLVGVSSHYATVERQYRNPTEQGVQKTPTSQW 159 Carboxydother...
P40869          84 DLLNQNVTANYVARHLKIPFLCMFGACSTSMETVAVASALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTATS 163 Bacillus subt...
BAD76589        84 DLLNQNATSNYVARELPIPFLCLFGACSTSMQTLAAAAAFVAGGLADRALAATSSHNATAERQFRYPTELGVQKPKTATF 163 Geobacillus k...
BAB05259        84 DLLNQNITANYVARALGIPFLGTFSACATSMETLAVGSIIVHGGFAQRVITATSSHYATAERQFRQPTEFAKQKPDSATY 163 Bacillus halo...
BAD64332        83 DLSNQTTASSFVARDLQLPYIGTYSACATSVETLIISGVWVSSGLADLVLAAASSHYGACEKQFRYPTEFAVQKPETAQT 162 Bacillus clau...
tigr:GBAA_5376  83 DLINQITPTSFACRTLGTPYLGLFGACSTSMEGLALGASIVNAKGAKYLLTGASSHNTAVEKQFRYPTEYGGQKPPTAQW 162 Bacillus anth...
BAD39188        88 DLLNQLITTAFSGLELGVPLYGLYGACSTFTEALSLGAKLIDGGFADRVLCAVSSHYGSAERQYRYPTEYGSQRKPYAQH 167 Symbiobacteri...
3LM6_A         164 TVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDXGSAXAPAAADTIKQHFKDLNRTADDYDLILTGDLSGVGSPIV 243 Bacillus subt...
AAK80260       165 TVTGAGAMLLARQGDFPYITFVTAGKVKDYGITSPDSMGEAMAPAAVDTIKQHFKDTGRTPQDYDVIATGDLGRVGKKIT 244 Clostridium a...
AAM24544       166 TVTGAGATILASTGEGPYITHATTGKVVDLGMKDANNMGAAMAPAAADTIITHFKDTGFTIEDYDLIMTGDMGRVGRDIL 245 Caldanaerobac...
tigr:CHY_1956  160 TVTGAAAVVLGEGEGKIKIPRVTVGKALDYGMFDPSDMGGAMAPAAFDTLLAHFKETGLSYDYYDLMATGDLARFGWQIL 239 Carboxydother...
P40869         164 TVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDMGSAMAPAAADTIKQHFKDLNRTADDYDLILTGDLSGVGSPIV 243 Bacillus subt...
BAD76589       164 TVTGAGAALVGRAPGRWRVRAATIGKVVDAGLKNPLDMGAAMAPAAADTIEQHFRDLGVSPGDYDLIVTGDLSRVGSVIV 243 Geobacillus k...
BAB05259       164 TVTGAGAALVSNRPSKVRIESATIGHVVDYGLKNPLDLGSAMAPAAAHTIVTHLEETDQQVDDYDLIVTGDLSRIGSGIL 243 Bacillus halo...
BAD64332       163 TVTGAGAVLLGKKRTEIQLTEATIGRVQDLGITDPMSLGAAMAPAAAEVTIGHLHKTNQQVSDFDLIVTGDLAISGSEIY 242 Bacillus clau...
tigr:GBAA_5376 163 TVTGAGAAILSDTGHGPRVTSATIGRVVDMGLTDPFNMGGAMAPAAVDTIEAHLRERQIDASYYDLIVTGDLGHVGREIA 242 Bacillus anth...
BAD39188       168 TVTGAGAVVLASAGEGPRITYCTTGKVVDWGVADPLNQGAAMAPAAVDTIEAHLRDTGRSVDDYDLIVTGDLAKFGYEMA 247 Symbiobacteri...
3LM6_A         244 KDILKED-GYPVG-TKHDDCGLLIYTPDQQ-VFAGGSGCACSAVVTYSHIFKQLREGKLNRVFVVATGALLSPTXIQQKE 320 Bacillus subt...
AAK80260       245 EDLLKKEyGYDMS-NIYMDCGEKIFNCDEQdTNSGGSGCGCSAVVDCGYIYKNMLSGKIKKALLISTGALMSTTSNLQGE 323 Clostridium a...
AAM24544       246 LELLYKE-GFDIA-DKYKDCGIEIF-YESQdVHSGGSGAACSAVVLNGWLLSQIRNGVYKKVLFMATGALLSPTSTYQGE 322 Caldanaerobac...
tigr:CHY_1956  240 VKLLQER-NINFG-QRLTDCGIMIYRPDQQ-VNAGGSGTACSALVTAGYVFNELSQGKIHKFLGIGTGALLSQVTSQQGM 316 Carboxydother...
P40869         244 KDILKED-GYPVG-TKHDDCGLLIYTPDQQ-VFAGGSGCACSAVVTYSHIFKQLREGKLNRVFVVATGALLSPTMIQQKE 320 Bacillus subt...
BAD76589       244 RELLAES-GYDVT-DVYNDCGLMIYRPDQK-VFAGGSGCACSAVVTYGYLLQELARGTFRRLFVVATGALLSQTMVQQKQ 320 Geobacillus k...
BAB05259       244 RKLLEEK-RVMFK-RNYDDCGVMIYSMDQP-VFAGGSGAACSAVVSYGYIFEQMKKGKLKKVLIVATGALLNPMMIQQKE 320 Bacillus halo...
BAD64332       243 RKLLREQ-GIYIT-GRYEDCGVMMYHSEQQ-VLAGGSGAGCSASVVYGHIYHRLLAGELKRVLVVATGALLSSMTVLQKQ 319 Bacillus clau...
tigr:GBAA_5376 243 YDLLHKH-GTKVTsEQFQDCGLLIYREGQP-VIAGASGPGCSATVVYGHLLNRMKRGEFNKILVVATGALLSPLTFQQEE 320 Bacillus anth...
BAD39188       248 RRLAAER-NLYLG-ENYRDCGVMVYDTTKQnVDSGGSGCASSAIVTCGHLLKEMARGRLRRLLVVSTGSLFSPTSFQQGE 325 Symbiobacteri...
3LM6_A         321 TIPTIAHGVVFE 332 Bacillus subtilis subsp. subtilis str. 168
AAK80260       324 SIPGIAHAVSIE 335 Clostridium acetobutylicum ATCC 824
AAM24544       323 SIPGIAHAITIS 334 Caldanaerobacter subterraneus subsp. tengcongensis MB4
tigr:CHY_1956  317 SIPVIAHAVSFE 328 Carboxydothermus hydrogenoformans Z-2901
P40869         321 TIPTIAHGVVFE 332 Bacillus subtilis subsp. subtilis str. 168
BAD76589       321 SIPAIAHGVVIE 332 Geobacillus kaustophilus HTA426
BAB05259       321 TIPCIAHAVSLR 332 Bacillus halodurans C-125
BAD64332       320 SIPAIAHAIVLE 331 Bacillus clausii KSM-K16
tigr:GBAA_5376 321 TIPCIAHAVSIE 332 Bacillus anthracis str. 'Ames Ancestor'
BAD39188       326 SIPTIAHAVAVE 337 Symbiobacterium thermophilum IAM 14863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap