Conserved Protein Domain Family
omega_3_PfaA

?
TIGR02813: omega_3_PfaA 
polyketide-type polyunsaturated fatty acid synthase PfaA
Members of the seed for this alignment are involved in omega-3 polyunsaturated fatty acid biosynthesis, such as the protein PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is encoded together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologs of PfaA, also included with the reach of this model, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis, an alternative to the more familiar iterated mechanism of chain extension and desaturation, and in most cases are encoded near genes for homologs of PfaB, PfaC, and/or PfaD.
Statistics
?
PSSM-Id: 274311
View PSSM: TIGR02813
Aligned: 3 rows
Threshold Bit Score: 4255.23
Threshold Setting Gi: 71143668
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668   22 NSRLQECPIAIVGMASIFADAKNLENYWDNIFESVDAIKDVPSDRWAKDDYYSSDPKEADKTYCKRGGFLPEIDFDPMEF 101
gi 46913082   26 NKRLKDMPIAIVGMASMFANSRYLNKFWDLISEKIDAITEVPETHWRPEDYYDANKSTPDKSYCKRGGFIPEVDFNPMEF 105
gi 24347382   21 NKRLKDMPIAIVGMASIFANSRYLNKFWDLICDKIDAITDVPASHWAIDDYYDVDKSKADKSYCKRGGFMPEVDFNPMEF 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  102 GLPPNILELTDIAQLLSLVVAREVLNDAGIGDGsgYDRDKVGITLGVGGGQKQISPLTSRLQGPVLEKVLKASGVEEADR 181
gi 46913082  106 GLPPNILELTDTSQLLSLIVAKEVLADAKLPET--YDRDKIGITLGVGGGQKISQSLNARLQYPVLKKVFKNSGITDEDS 183
gi 24347382  101 GLPPNILELTDSSQLLSLVVAKEVLQDANLPDD--YDRDRIGITLGIGGGQKLSHSLNARLQYPVLKKVFKSSGLSDEDS 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  182 AMIIEKFKKAYIGWEENSFPGMLGNVISGRIANRFDFGGTNCVVDAACAGSLAAIKLAISDLLEHRSEVMISGGVCCDNS 261
gi 46913082  184 EMLIKKFQDQYIHWEENSFPGSLGNVISGRIANRFDLGGMNCVVDAACAGSLAALRMALSELVEGRSEMMITGGVCTDNS 263
gi 24347382  179 ELLIKKFQDQYVHWEENSFPGSLGNVIAGRIANRFDLGGMNCVVDAACAGSLAAMRMALTELTEGRSDMMITGGVCTDNS 258
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  262 PFMYMSFSKTPAFTTGEDIRPFDNDSKGMMIGEGIGMMAFKRLEDAERDGDKVYAVLKGIGTSSDGRFKSIYAPRPDGQA 341
gi 46913082  264 PTMYMSFSKTPAFTTNETIQPFDIDSKGMMIGEGIGMIALKRLEDAERDGDRIYSVIKGVGASSDGKFKSIYAPRPEGQA 343
gi 24347382  259 PYMYMSFSKTPAFTTNEQIQPFDIDSKGMMIGEGIGMVALKRLDDAERDGDRIYAVIKGVGASSDGKFKSIYAPRPEGQA 338
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  342 KALKRAYEDAGFDPKSCGMIEAHGTGTKAGDAAEFGGLVKHFSQDNDQKQHIALGSVKSQIGHAKAAAGAAGMIKAVLAL 421
gi 46913082  344 KALKRAYDDAGFAPHTLGLLEAHGTGTAAGDVAEFSGLNSVFSEGNDEKQHIALGSVKSQIGHTKSTAGTAGLIKASLAL 423
gi 24347382  339 KALERAYDDAGFAPHTVGLIEAHGTGTAAGDVAEFTGLSSVFSQDNAQLQHIALGSVKSQVGHTKSTAGTAGVIKAALAL 418
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  422 HHKVLPATLHIDQPNTSLDIENSPMYLNSETRPWMAREDGLPRRAGISSFGFGGTNYHMVLEEYSPKAQG--QYRLNAVP 499
gi 46913082  424 HHKVLPPTINVTSPNPKLNIEDSPFYLNTQTRPWMQRVDGTPRRAGVSSFGFGGTNFHIVLEEYTPEHARgdKYRQRQVA 503
gi 24347382  419 HHKVLPPTINVSKPNPKLEIDRSPFYLNTEARPWIQRSDDTPRRAGISSFGFGGTNFHLVLEEYRPDHTRddAYRQRSVA 498
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  500 QTLLVTAANEKALVSSLTdw-knKLSVKADDQPYAFNALVVENTLTTPAVALARCGFVAKNADEAIKMIEGALTQFQAKS 578
gi 46913082  504 QTLLFSAASREALIASLK-----ETSANLANDSVNLETLAESHGLRSIEVSHARLGLAVKTGEELNTQLAQAISNLESQT 578
gi 24347382  499 QILLFAANDKTLLLNELKavlqqASSAKAELSEAHFIQFAKPYALREITPQSARLGFIAKDYAQLQTLLTQAIAQLEANN 578
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  579 ggdipCEEWSVPTGIYYRKSGLSV---SGKVVALFSGQGSQYVNMGRELACNFPSVMQAAADMDSEFTQAGLGQLTPTTY 655
gi 46913082  579 -----KAHWQLPSGTSYRESALVSgndSAKVAALFAGQGSQYLNMGRELACHYPEMRQQLAKADQVFGQNKKTALSQVLF 653
gi 24347382  579 -----AESWQLPSGISYRAKALVNe--QTKIAALFAGQGAQYLNMGLELANNFPELRRHIHASDKVFSTHGKPALSSVLY 651
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  656 PIPVFNDDARKAQDEALRLTQHAQPAIGTLSVGLYKAFTNAGFKADFTAGHSFGELTALWAAGVVSDSDYMMLARSRGQA 735
gi 46913082  654 PIPMFNKESTQAQEALLTNTANAQSAIGVMSMGQFELLTQAGFKADMVAGHSFGELSALCASGVISQDDYYQLAFARGNA 733
gi 24347382  652 PIPAFDDESIKAQETALTNTLYAQSAIGALSMAQYALFTQAGFAPDMLAGHSFGELSALCAAGVISMDDYIKLAFERGQA 731
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  736 MAAPTGEAAIGFDAGTMIAVVGSPTDIAnDIKDIKDISIANYNSNNQVVVAGVSTQIAIAIDELKGKGYKVVPLPVSAAF 815
gi 46913082  734 MAATPAEGDSGTMYAVILDADKLADVEK-CISAFEGVSIANYNAPTQLVIAGPTDSAQLAAKALTEQGFKAIPLPVSGAF 812
gi 24347382  732 MAQSSQDTDAGVMYAVILKQKQDIEVINgCLAQFEGVKVANYNSPTQLVIAGASAATQQAAKAISELGFKAIALPVSGAF 811
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  816 HTPLVGHAQKPFSDAIDNAKFNKPLVPVYSNGTAKAHSNKAADIKKSLKNHILESVHFNEEIDNIYADGGRVFVEFGPKN 895
gi 46913082  813 HTPLVAHAQKPFAAAIDKATFSTPALPLYSNATGELHKNDGKAIKKAFKQHMLQSVRFSTQLEAMYDAGARVFVEFGPKN 892
gi 24347382  812 HTPLVAHAQKPFSAAIDKAQFNTPKIALYANGTGQLHPIDANAIKAALKDHMLQSVHFSEQLEAMYAAGARVFVEFGPKN 891
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  896 VLTKLVENILKDKE-DVVAIAVNANPKKSADMQMRQAAVQMAVLGLELTEIDPYSAVKRPLSAPkmSPLAMKLTGASYVS 974
gi 46913082  893 ILQKLVEKTLTNKAdELCTISINPNPKGDSDQQLRLAAVQLAVVGISLDNIDPYQAEIAPPAAT--SPMNIKLNAANYIS 970
gi 24347382  892 ILQKLTENTLAAQLnELCIISINPNPKGDSDSQLRSAAVQLAVAGVKLREIDPYQAELIAPAAT--SAMNIKLNATNYIS 969
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668  975 PKTKKAFDDALNDGWTIKQATSVpvavpePQVVEKIVEKIVEVERIVEVERIVYLTADGKVFDGSVADGTVANGQAANSV 1054
gi 46913082  971 PATRAKMAKSLTTGEVSTKTEIV------EKVVEKIVEKEVIKTEIREVPVAAAPTQAVTVQSTAQAAPQPVVTTAPAQV 1044
gi 24347382  970 PATRSKMVDSLQSGKITSQVQYV------DRIVEKVVEKVVEKPVIVEK----ILEKVVEVEKPVAQNSNNIQQQTPAQP 1039
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1055 AVnvNTADIANSIERSVSQFVDHQQQLLNVHEQYMQGPKDYAKTFDTVLSNQE-----AGELPESLDRTLGMYHDFQSET 1129
gi 46913082 1045 VT--QATSQLPVGEASLHAFFSAQQQAAELHQQFLAIPQQYGDTFTALMTEQAkmataGIAIPESLQRSMELFHQHQAET 1122
gi 24347382 1040 AS--FTAGQT--NQDALSAFFAAQTQAAQLHQQFLAIPQQYGDTVSALMAEQAkmaslGIAIPESLQRSMELFHQHQAQT 1115
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1130 LRVHEQYLNNQTDnmatmlsasesntevsSNIVKTSPIATQAPVIKSVVTQAPVVKPTISVAPATQTLPAAVSPPVVSAp 1209
gi 46913082 1123 LKAHAHYLELQAN----------------SNNSALGMLTSQAPAHQVPVYQTPIQQVSVAPAPAAPVVTPVVAAPVATP- 1185
gi 24347382 1116 LKSHSDFMQLQTS----------------SSQAVLALLG-----------QMPASQVQAPIQAAAPVAVAVTKPVVPAQ- 1167
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1210 vvnAPAQSVATAVAMAPVAEVSIAVPVQESsldleriqtvmmevvaektgyptemlelemdmeadlgidsikrveilgsv 1289
gi 46913082 1186 ---TPIKAVIQTQQSAPVASAPIAAPVTQT-------------------------------------------------- 1212
gi 24347382 1168 ---APVVQGLAAEP--KVTAVPVSEPTVQ--------------------------------------------------- 1191
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1290 qeiiadlpelnpedlaelrtlgeiVDYMKSKAQAAAPSASANDSApalhlvdssvvpsidlqhIQNVMMEVVAEKTGYPT 1369
gi 46913082 1213 ------------------------VKPTPVVQAAVAPQAAVQTAN------------------PEQVMLEVVAEKTGYPT 1250
gi 24347382 1192 ---------------------------QPQVALAQVAQTKVTQPP------------------LAQPQVQTVAAQT---- 1222
                       1370      1380      1390      1400      1410      1420      1430      1440
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1370 EMLELEMDMEADLGIDSIKRVEILGSVQEIINDLPELNPEDLAELRTLGEIVNYMQSKVSAApVASAPVNTTVSSTpaiD 1449
gi 46913082 1251 EMLDLDMDMEADLGIDSIKRVEILGTVQDQMPNLPELSPEDLAECRTLREIVTYMNSKMPAA-AASAPVTSASNGL---D 1326
gi 24347382 1223 ----------------------------------------------------------------SALQVKPALQ------ 1232
                       1450      1460      1470      1480      1490      1500      1510      1520
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1450 LIHIQNVMMEVVAEKTGYPTEMLELEMDMEADLGIDSIKRVEILGAVQETIPDLPELNPEDLAELRTLGEIVSYMQSKVS 1529
gi 46913082 1327 AAQVQSTMLEVVADKTGYPTEMLDLEMDMEADLGIDSIKRVEILGTVQDQLPTLPELSPEDLAECRTLGEIVSYMNSKLP 1406
gi 24347382 1233 --QIEHAMLSVVADKTGYPVEMLELSMDMEADLGIDSIKRVEILGTVQDELPNLPELSPEDLAECRTLGEIVALFSQAAP 1310
                       1530      1540      1550      1560      1570      1580      1590      1600
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1530 VAPAAVAAIVPNATANASApAIDLDYIQSVMMTVVAEKTGYPTEMLELEMDMEADLGIDSIKRVEILGAVQETIPDLPEL 1609
gi 46913082 1407 AASAVAAPVASAPVASASN-GLDAAQVQTTMLDVVADKTGYPTEMLDLAMDMEADLGIDSIKRVEILGTVQDQLPGLPEL 1485
gi 24347382 1311 VTSATTVSHATQSAVAASA-AVSNDEIERTMMAVVADKTGYPVEMLELSMDMEADLGIDSIKRVEILGTVQDELPNLPEL 1389
                       1610      1620      1630      1640      1650      1660      1670      1680
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1610 NPEDLAELRTLGEIVSYMQSKVSVAPIAVVDNAQAASaiVPTKVSsapAIDLDYIQSVMMTVVAEKTGYPTEMLELAMDM 1689
gi 46913082 1486 NPEDLAECRTLGEIVDYMNSKLPAVSTQNVAIQTAAP--VASASN---GLDAAQVQGTMLEVVADKTGYPAEMLDFAMDM 1560
gi 24347382 1390 SPEDLAECRTLGEIVALFSQAVPVAAQTFAAMAATNPqvVASAVTpiaAVSDGEIEHTMMAVVADKTGYPVEMLELSMDM 1469
                       1690      1700      1710      1720      1730      1740      1750      1760
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1690 EADLGIDSIKRVEILGAVQETIPDLPELNPEDLAELRTLGEIVSYMQSKVTPVADVTAETSTLANESAPAIDLD-----Y 1764
gi 46913082 1561 EADLGIDSIKRVEILGTVQDQLPGLPELNPEDLAECRTLGEIVDYMNSKLPAASTQNVAVQTVAAPVATAPATNgldaaH 1640
gi 24347382 1470 EADLGIDSIKRVEILGTVQDKLPNLPELSPEDLAECRTLGEIAALFSQAAPVTAAATVSHATQSAIAARAAVSNd----E 1545
                       1770      1780      1790      1800      1810      1820      1830      1840
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1765 IQSVMMTVVAEKTGYPTEMLELAMDMEADLGIDSIKRVEILGAVQETIPDLPELNPEDLAELRTLGEIVSYMQSKVSPTD 1844
gi 46913082 1641 VQNTMMNVVADKTGYPAEMLDLAMDMEADLGIDSIKRVEILGTVQDQLPGLPELNPEDLAECRTLGEIVAYMQSKLSNTS 1720
gi 24347382 1546 IERTMMAVVADKTGYPVEMLELSMDMEADLGIDSIKRVEILGTVQDQLPNLPELSPEDLAECRTLGEIVALYAGSQSSSE 1625
                       1850      1860      1870      1880      1890      1900      1910      1920
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1845 PTDPKgtgVKTTVPAAVLANGRSVEtaVNFQgaPSATVELTALSSVNKIVQDVTgeg-kqsGANALVVDDGSGAAVALSA 1923
gi 46913082 1721 AVAAP---SAPAVENLVEAIAETSN--VELP--PHSEVALKKLPAVDKLVDCFS-------KEACIVITDDGHNAGVLAE 1786
gi 24347382 1626 ALQQN---HAATIQETQEAIAKTVEetIDLP--PHSEVMLKKLPAAAELARIIAtsdvqltANSYVVIGDDGHNAGVIAE 1700
                       1930      1940      1950      1960      1970      1980      1990      2000
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1924 QLIKAGWQVTALKPNwvvSHSKKAFATAVNVVEIGTHDKTLDEAQVKDIIEKTAQLDAVIYLQA------ANTVDAIEYP 1997
gi 46913082 1787 KLSANGLQVAVVRSP---LSAASPLNSEIASYTLASIDDASIKTVISDIESKQKEIGGFIHLQPlatdakTDKATAVTLH 1863
gi 24347382 1701 KLHAQGVKVAVVRSPktvVTSASPLDSHIASFTLEAIDDESICEVINQIEALG-QIAGFIHLQPqhk-svADKGAGLVLV 1778
                       2010      2020      2030      2040      2050      2060      2070      2080
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 1998 EAAKQGLMLAFVLAKLSNVKLATN-ARASFVVVTRQGGALGFSNGDADSGtqqvkanvkADLVQAGLAGLVKTINHEWNA 2076
gi 46913082 1864 ATAKESISMAFLFAKLLKTQLNAAkNRSAFFTVSRIDGGFGYLNAEQLIN---------AELNQAALSGLTKTLSHEWST 1934
gi 24347382 1779 DEAKASVEQAFLFAKFLQPLLTER-DYCRFVTVSCIDGGFGYIGMDESVGali----sqSELNQAALFGLTKTLNHEWPG 1853
                       2090      2100      2110      2120      2130      2140      2150      2160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 2077 gegsVFCRIIDLSSKLAADKAATIINDELLDIDGSIVEVAHDTDNLSNniGSRLTLSGVVTDsyalTPIAKGSNTAINSD 2156
gi 46913082 1935 ----VFCRALDVAPTLDARHLAEAVTAELFDIDTHTVEVGLADANNGE--SGRATLIATNAG----TALTKNASAKLDKN 2004
gi 24347382 1854 ----VVCRALDIAPNLDAKTVANAVVQEYYLQDAP-VEVGIDSN------FDRVTLVAG-------TAALRHPPAVLSNA 1915
                       2170      2180      2190      2200      2210      2220      2230      2240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 2157 SVFLVSGGAKGVTAHCVIEIAKQYQAKFILLGRSS--FDDNEPSWAQGIsDEVALKKAAMQALIASGEKPTPVKVTQFVR 2234
gi 46913082 2005 DNVLVTGGAKGVTFECALTLAKQCKSHFILAGRSQhiTANELPEWAQGK-QANELKPAAIRHIQTSGEKPTPKKVDALLK 2083
gi 24347382 1916 DKILVTGGAKGVTFECALSLAKRCQAHFFLAGRS---AHQVIPAWAEGK-KSNELKAAAIAHLQSLGDKPTPKQVDALVW 1991
                       2250      2260      2270      2280      2290      2300      2310      2320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 2235 PVLANREIAQTLAAIKAAGGQAHYAAADVTNSVSVSAAVQPLLktlgqgslQVTGIIHGAGVLADKFIEQKTLEEFNAVY 2314
gi 46913082 2084 PVLSSLEINTALSAFANVGASAEYISLDVSSSDSVAKTLSQFN--------DITGLIHGAGVLADKHIQDKTLDELNLVY 2155
gi 24347382 1992 PVQSSLEISHALAAFDAIGASAEYLSVDVNDPAAIASTIAPINal-----sPITGIIHGAGVLADKHIQDKTLNEFERVY 2066
                       2330      2340      2350      2360      2370      2380      2390      2400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 2315 TTKIDGLLSLLAATNAENIKHLVLFSSAAGFYGNPGQSDYSIANDILNKTAYRFKALNPSAQVLSFNWGPWDGGMVTPEL 2394
gi 46913082 2156 GTKVGGLEAVLNALNSDKLKLVAMFSSAAGFYGNTGQSDYAMSNEILNKAALQLSARNPEAKVMSFNWGPWDGGMVNAAL 2235
gi 24347382 2067 GTKVTGLNNLLSTLDLSQVKLIALFSSAAGFYGNTGQSDYAMSNDILNKAALQLAQQLPQAKVMSFDWGPWDGGMVNPAL 2146
                       2410      2420      2430      2440      2450      2460      2470      2480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 2395 KRMFNDRGVYIIPLDAGAKLLVSELAADTNrcAQILVGNDLSK---DTAKDASVKKPQVSRLTSRVN------------- 2458
gi 46913082 2236 KKMFTDRGVYVIPLQAGAELFSSQLLSETG--IQLLVGTSMQGs--DNKEAAVKKLDAESMLVAKSPlnss------itv 2305
gi 24347382 2147 KKMFIDRGVYVIPLKAGAELFASQLLSDTG--AQLLVGTDMQGntaNAVEVASAKKPEADLATALDPqpmaqtvpqsirv 2224
                       2490      2500      2510      2520      2530      2540      2550      2560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 2459 -KTLLATNNTFLADHTIGDDKVLPTVCAIAWMSEAAMVAYPAFhyQGLANYKLFKGIIFDGSEATEysidmiAQVEGESl 2537
gi 46913082 2306 tRDLDPKAMPFINDHCIAGNPVLPTVCAIQWMREAAEQLLGAN--VTVRDYKLLKGVIFDTNEIQT------LTLTLTP- 2376
gi 24347382 2225 mRSLDPKRMSFIEDHCINGHAVLPTVCAIDWMREAAKAHLGTA--VSVSDYRLLKGVIFDEALLARnap-ieLELMLTPl 2301
                       2570      2580      2590      2600      2610      2620      2630      2640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 2538 vvdTKISSTNEQGKPVFHYGAQLTLVAKAERKEAPTVELILPEALPellpe-tvlsSTEEAGALYTNGTLFHGESLQGIK 2616
gi 46913082 2377 ---DEKATDQIKALISCQDRPQYKAMLVVEPVPATQAKTFVANSNE----------PITTAKALYSNGTLFHGPRLQGIT 2443
gi 24347382 2302 adaAQQSTEALAALISFEGRPQYQAVLVAQTDDMPDAQRFEVGELHsliqemaqqpAIANRESLYSDGTLFHGPRLQGIS 2381
                       2650      2660      2670      2680      2690      2700      2710      2720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71143668 2617 AILACNEQGLLLKCQVPAVASLKQGEFPISPLNSASEHsniFANDIAYQAMLVWAKKQLGLGSLPSSTQSWTVYRDVSLG 2696
gi 46913082 2444 TVERFDDAGLLAQCQLPTVADTDCGAFVPTQHLGGCQP---FAEDYLLQAMLVWARLKYGAASLPSAIGEFVSYEPMQAG 2520
gi 24347382 2382 EVLTFDDQHLMAKVELPQVALDDCGKFAPKLEDKGTQP---FAEDLLLQAMLVWARLKYQAASLPSTIGEFVSYAPLSFG 2458
                       2730      2740      2750      2760      2770
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 71143668 2697 ENFYLKLTVVKSSGKgkqrgSLVADIEMIDENNRLLSEIKSAKVTASANLNDLFL 2751
gi 46913082 2521 DKGWLELDVIKNTTR-----SLQANISLYHQDGRLSAVMKSAKVTISKSLNEAFL 2570
gi 24347382 2459 EKAVLVLDVLKHSSR-----SLEANIALYHQDGRLSCEMKRAKVTISKTLNQAFL 2508
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap