Conserved Protein Domain Family
CobW

?
TIGR02475: CobW 
cobalamin biosynthesis protein CobW
The family of proteins identified by this model is generally found proximal to the trimeric cobaltochelatase subunit CobN which is essential for vitamin B12 (cobalamin) biosynthesis. The protein contains an P-loop nucleotide-binding loop in the N-terminal domain and a histidine-rich region in the C-terminal portion suggesting a role in metal binding, possibly as an intermediary between the cobalt transport and chelation systems. A broader CobW family is delineated by two Pfam models which identify the N- and C-terminal domains (pfam02492 and pfam07683). [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 274151
View PSSM: TIGR02475
Aligned: 6 rows
Threshold Bit Score: 499.661
Threshold Setting Gi: 22295349
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15074980    8 QRKIPATVITGFLGAGKTTMIRNLLQNADGKRIALIINEFGDLGVDGDVLKGCGAEACSEE----DIIELTNGCICCTVA 83
gi 14022152    5 VTRVPCTVVTGFLGAGKTTLVRHLLENAGGKRIAIIVNEFGDIGIDGEILKGCGIDTCPEE----NIVELANGCICCTVA 80
gi 27351521    4 LAKVPVTVVTGFLGSGKTTLIQHLLANPNGKKLAVLVNEFGSEGVDGQILKSCADANCPEE----NIVELANGCICCTVA 79
gi 22295349    2 SAKIPVTIITGFLGSGKTTLIRQLLQNAAGRRIAVIVNEFGDVGIDGELLQAC----CDRTv---GIWELTNGCLCCTVQ 74
gi 489702492   4 VEKIPCTIVTGFLGAGKTTLVRHTVENARGRRLAIIVNEFGDLGFDGSFLAACGIEGCNED----SVVELPNGCICCTVA 79
gi 489204937   4 LAKLPVTIVTGFLGAGKTTLLRHMLDNAEGRRIAVIVNEFGELGIDGEILKQCSI-GCSEEeaqgRVFELANGCLCCTVQ 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15074980   84 DDFIPTMTKLLERENRPDHIVIETSGLALPQPLVAAFNWPDIRSEVTVDGVVTVVDSAAVAAGRFADDHDKVDALRVGDD 163
gi 14022152   81 DDFVPALDQILSLNPKVDHILIETSGLALPKPLVQAFQWPTVKSRVTVDGVIAVVDGPALAEGRVANDMDALQAQRAGDD 160
gi 27351521   80 DDFIPTMELLLARPVRPDHILIETSGLALPKPLLRAFDWPEIRSRITVDGVIALADAEAVAAGRFAPDPAAVEAQRAADE 159
gi 22295349   75 DEFLPTMQTLLARRQEIDHIVIETSGLALPKPLVMAFRWPEVRHTATVDGVVTVVDGVALAAGQVSADLEALFAQKEADA 154
gi 489702492  80 DDFVPALTKLLDRPEPPEHILIETSGLALPKPLVQAFQWPAIRSRVTVDGVVAVVDGPAVAAGMFAEDPDALANQRAADQ 159
gi 489204937  83 EEFFPVMRELVARRGDLDQILIETSGLALPKPLVQAFQWPEIRNACTVDAVITVVDSPAVAAGTFAAHPEQVDQQRRQDP 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15074980  164 NLDHE-SPLEELFEDQLTAADLIVLNKTDLIDAAGLKSVREEVASRISRKPTMIEARNGEVAAAILLGLGVGTEGDIVNR 242
gi 14022152  161 SLDHD-DPVEELFEDQIACADLIILSKSDLMDAAGSARANAIIGEHSARAVKIVSTSHGKVDPSVLLGLGLAVEDDIENR 239
gi 27351521  160 NLDHE-TPLSEVFEDQIACADIVLLTKADLAGPAGLEAAKAAITAEMPRRVPMLAVTDGAIDARVILGLGAAAENDLAAR 238
gi 22295349  155 NLQHEdTPLEELFNDQLACADLVILNKADQLTPDQVQQCLRELRQQLPTRIKVLAAQQGQVPADLLLGFNAAVEENLGQR 234
gi 489702492 160 SVDHD-NPLEEVFEDQILCADLVVLNKADLLDAAGRDKVRADIQAHLPRAVEIVETEHGRLDPRVLLGIAAAAEDDLDAR 238
gi 489204937 163 NLDHE-SPLHELFEDQLASADLVILNKADQLDAEALARVRAEIAGELPAAVKIVEASRGELPLPVLLGLNAEAELHIDGR 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15074980  243 KSHHEmeheAGEEHDH-DEFDSFVVELGAIADPAAFTERLKGVISEHDVLRLKGFVDVPGKPMRLLVQAVGSRIDQYFDR 321
gi 14022152  240 KSHHD----GAFDHEH-DDFDTFIVDIPSIANPDELAQRVAAAAEQENVLRVKGFVEVGGKPMRLLLQAVGPRVNHYYDR 314
gi 27351521  239 PSHHD----GEEEHEH-DDFASVVIDLPEVGDVDALVASVQRLAREQNVLRAKGYIAVAGKPMRLLLQAVGERVRHQFDK 313
gi 22295349  235 PSHHDfe----eEHDHdEEIQAVCLELG-VWDLQRLRQSLERLLHVPDIYRIKGFAAIEDKPLRLVVQGVGQRLDSFYDR 309
gi 489702492 239 PSHHg----EGEDHDH-DDFESVAIPVGIAGSPEDLSARVEKAAETEGVLRIKGFAEVKGKPMRLVVQGVGRRVASHYDR 313
gi 489204937 242 PT-HHdh-eGHEDHDH-DEFDSFHVDLPEVEE-AALLEALGELVERHDILRIKGFAAIPGKPMRLLVQGVGKRFDRHFDR 317
                        330       340       350
                 ....*....|....*....|....*....|
gi 15074980  322 AWASGQTRSTRLVVIGLH-DMDEPAVRAAI 350
gi 14022152  315 AWTAEDDRRSRLVVIGLK-GLNRPAIERIL 343
gi 27351521  314 PWG-ALARQSKLVVIGEHgDIDEAAIRAGL 342
gi 22295349  310 PWQAAETRQTRLVVIGRR--LDQRELLSHF 337
gi 489702492 314 PWKGSEPRDGRLVVIGLK-GFDQDAVAAAL 342
gi 489204937 318 KWLADEARSTRLVVIGQE--LDQAAIANQL 345
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap