Conserved Protein Domain Family
FadI

?
TIGR02446: FadI 
fatty oxidation complex, beta subunit FadI
This subunit of the FadJI complex has acetyl-CoA C-acyltransferase (EC 2.3.1.16) activity, and is also known as beta-ketothiolase and fatty oxidation complex, beta subunit, and YfcY. This protein is almost always located adjacent to FadJ (TIGR02440). The FadJI complex is needed for anaerobic beta-oxidation of short-chain fatty acids in E. coli. [Fatty acid and phospholipid metabolism, Degradation]
Statistics
?
PSSM-Id: 131499
View PSSM: TIGR02446
Aligned: 3 rows
Threshold Bit Score: 811.529
Threshold Setting Gi: 27361467
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CMCP6:VV1_1975   6 VKTRQGERVAIVAGLRTPFARQSTEFSQVPAVDLGKMVVSDLLARTDIDPKLIEQVVFGQVVQMPEAPNIAREIVLGTGM 85  Vibrio vulnif...
AAN56096         7 VTNARGERIAIVAGLRTPFAKQATAFHGISALDMGKMVVNELLVRSELDPKLIEQLVYGQVVQMPAAPNIAREIVLGTGM 86  Shewanella on...
P76503           7 LVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPAEVIEQLVFGQVVQMPEAPNIAREIVLGTGM 86  Escherichia c...
CMCP6:VV1_1975  86 NIHTDAYSVTRACATSFQSAVNVAESIMAGAIDIGIAGGADSSSVLPIGVSKKLAASLLALSKTKTLGQKLKVLSGLGLK 165 Vibrio vulnif...
AAN56096        87 DVSTDAYSVTRACATSFQSAVNVAESIMTGNIEIGIAGGADSSSVLPIGVSKKLAHALVDLNKARTFGQKLQIFRRLGIK 166 Shewanella on...
P76503          87 NVHTDAYSVSRACATSFQAVANVAESLMAGTIRAGIAGGADSSSVLPIGVSKKLARVLVDVNKARTMSQRLKLFSRLRLR 166 Escherichia c...
CMCP6:VV1_1975 166 DLMPVPPAVAEYSTGLSMGQTAEQMAKTHGITRAEQDALAHRSHTLASQAWRDGKIAGEVMTAFPEPYKKWIAEDNNIRH 245 Vibrio vulnif...
AAN56096       167 DLLPVPPAVAEYSTGLSMGQTAEQMAKTYNISRADQDALAHRSHTLANETWASGHLRDEVMVAHVPPYKQFIERDNNIRE 246 Shewanella on...
P76503         167 DLMPVPPAVAEYSTGLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWSDGKLKEEVMTAFIPPYKQPLVEDNNIRG 246 Escherichia c...
CMCP6:VV1_1975 246 DSTLEGYAKLRPAFDRQYGSVTAANSTPLTDGAAAVLLMREGRAKELGMEILGYIRGYAFSAIGVESDMLMGPSYATSKV 325 Vibrio vulnif...
AAN56096       247 NSDLASYAKLRPAFDKKHGSVTAANSTPLTDGASAIILMSEGRAKALGYQPIGYIKSYAFTAIDVWQDMLMGPSYATPLA 326 Shewanella on...
P76503         247 NSSLADYAKLRPAFDRKHGTVTAANSTPLTDGAAAVILMTESRAKELGLVPLGYLRSYAFTAIDVWQDMLLGPAWSTPLA 326 Escherichia c...
CMCP6:VV1_1975 326 LQSTGLALSDLTLIDMHEAFAAQALANVKMFASDKFAQENLGRSKAMGEIDMDKFNVLGGSIAYGHPFAATGARMMTQTL 405 Vibrio vulnif...
AAN56096       327 LKRAGMELEDLTLIEMHEAFAAQTLANMQMFASKKFAEEKLGRNRAIGDIDMSKFNVLGGSLAYGHPFAATGTRLITQVC 406 Shewanella on...
P76503         327 LERAGLTMSDLTLIDMHEAFAAQTLANIQLLGSERFAREALGRAHATGEVDDSKFNVLGGSIAYGHPFAATGARMITQTL 406 Escherichia c...
CMCP6:VV1_1975 406 RELKRRGGGLALNTACAAGGLGAAMILEVE 435 Vibrio vulnificus CMCP6
AAN56096       407 RELKRRGGGTGLATACAAGGLGAAMIVEVE 436 Shewanella oneidensis MR-1
P76503         407 HELRRRGGGFGLVTACAAGGLGAAMVLEAE 436 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap