1RYI


Conserved Protein Domain Family
thiamin_ThiO

?
TIGR02352: thiamin_ThiO 
Click on image for an interactive view with Cn3D
glycine oxidase ThiO
This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as E. coli that instead use tyrosine and the ThiH protein. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
Statistics
?
PSSM-Id: 274092
View PSSM: TIGR02352
Aligned: 13 rows
Threshold Bit Score: 312.377
Threshold Setting Gi: 7388300
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RYI_A               34 YYLAKENKNTALFESGt-mGGRTTSAAA-GMLGAHAECE-ERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFK 110 Bacillus...
tigr:GBAA_0730       21 HFLAERGHKVAIVEKQq-iASEASKAAA-GLLGVQAEWD-EYDPLFDLARESRAIFPQLAEVLREKTGIDIGYEEKGIYR 97  Bacillus...
O31616               21 YYLAKENKNTALFESGt-mGGRTTSAAA-GMLGAHAECE-ERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFK 97  Bacillus...
Q55710               21 VELKLKQKRLQVTVLSrdfAQAASHAAA-GMLAPHAEQI-APGPMLDLCLASRWRYGEWVEKLEQLTGMETGYNPCGILS 98  Synechoc...
BAC18744             18 VRLADAGHVVTLVDPDp--ASGATHHAG-GMLAPVAEVVyRQEALFPLMLRSAALYPGLLRVVDKHTDLPTGYRTEGTLV 94  Coryneba...
CAE48542             17 FELSSRGHSVHVFDPNp--ASGASHFAG-GMLAPAAEVQfQQDPLFPLMKRAGKLWPDMVRRVAQRTNLPTGYRTEGTLV 93  Coryneba...
CAD93286             24 RRAAQAGWPVRVHRSD---ERGASWVAG-GMLAPHSEGWpGEERLLRLGLQSLRLWREGSFLDGLGPQLVTAH---ESLV 96  Mycobact...
lhbprmlnih:CBU_0331  19 WQLSKVGFGVTLFDKDdksGQKSTAYAAaGMLSPVAECEiAEQIIFNLGSYSLRKWPLWLSSL----NQPVYFKQNGSIV 94  Coxiella...
O34292               17 WQLYRHGFRVTLAERAgtvGAGASGFAG-GMLAPWCEREsAEEPVLTLGRLAADWWEAAL---------PGHVHRRGTLV 86  Rhizobiu...
CAD84561             19 LRLLEEGASVTLLDRRe-aGCEASWAGG-GILSPLYPWN-YSDSVTRLAAYSMSRYPEWTAALNTATGIDPEYQICGLVI 95  Nitrosom...
WP_010897599         15 FELKVRGHQVTVLEQGl-cGGQASGAAA-GMLAPFSEIGeDPNDFFHLAHESLKMYPDWQQAVKEISGKSFEYVQSGSLH 92  Bacillus...
CAD55293             34 WRAARRGLVTALVDPEp--GGGAAQVAA-GMLAAVTELHyGEETLLALNLASARRYPEFAAELTELTGHDLGYRRCGTLA 110 Streptom...
WP_010880422         17 VELLLAGHDVRLLVRDk--REGASWVAG-GMLAPFSEG--LRGDFLRFSVESLRLWHDYLERLKEISGRKVFFSQ-GILR 90  Aquifex ...
1RYI_A              111 LAFSEEDVLQLRQMDDLDS------VSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEH 184 Bacillus...
tigr:GBAA_0730       98 IAQNEDEKERILHIMDWQQktg-edSYFLTGDRLREQEPYLSESIIGAVYYPKDGHVIAPELTKAFAHSAAISGADIYEQ 176 Bacillus...
O31616               98 LAFSEEDVLQLRQMDDLDSv------sWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEH 171 Bacillus...
Q55710               99 PVFEAPHGNSSTNSAWLDQe------------tIRYYQPGLGEDVIGGWWHPDDGQVDNRKLVSALRQAAQSLGVQIQEG 166 Synechoc...
BAC18744             95 VAADRADAAHLAQLSDYQSang-meVERLTLRAARRLEPALSPQLAGAVHIPGDHQINPRMFAAALLDALDNLGVEVRR- 172 Coryneba...
CAE48542             94 VAADRADAEHLKQLRATQEaag-mdVRPITTRQARGLEPALGPRLSAAVHIPNDTQVAPRVFLTALLDALDDCGVGVIK- 171 Coryneba...
CAD93286             97 VAVDRADVADLRTVADWLSaqg-hpVIWES--AARDVEPLLAQGIRHGFRAPTELAVDNRALLDVLCRDCERLGVRWSSq 173 Mycobact...
lhbprmlnih:CBU_0331  95 ISHSHDEVEKERWLKQISRkikdfsLEKLSSSALQRLEPELN--FDEGYYLPQEAHLDSRALMQTLEKELNVEWHSKTF- 171 Coxiella...
O34292               87 VAGGRDTGELDRFSRRTSg------WEWLDEVAIAALEPDLAGRFRRALFFRQEAHLDPRQALAALAAGL---------- 150 Rhizobiu...
CAD84561             96 LPPCDPEAAVNWCSAHAVRlt---yLSSSHHGGLSWAHINDEQGNAQALFLPEVAQVRNPRLLQALYKRIRQLGGKIIEH 172 Nitrosom...
WP_010897599         93 CVYHEADFLELESRQHWQGtfg-veSEILSQQQIRALEPNISDEIIGAIYYPEESHLFAPDYVKALEIGCRKLGVTIEDE 171 Bacillus...
CAD55293            111 VALDADDRAHLRELHALQQrsg-leSEWLSGRECRRLEPMLAPGVRGGLRVDGDHQIDPRRLARALVAACEHAGVVFHRV 189 Streptom...
WP_010880422         91 VAFDEKEEKKLREDVKFYSqevcqnLISYDAEELLKEFPYLSSEVRYGVIYGDEGNVDTEELMEALYVAFEKLGGEIINE 170 Aquifex ...
1RYI_A              185 TPVLHVERDGE-ALFIKTPSG-DVWANHVVVASGVWSGMFFK------QLGLNNAFLPVKGECLS--VWNDDIPLTKTLY 254 Bacillus...
tigr:GBAA_0730      177 TEVFDIRIENKkVIGIVTSEG-MISCEKVVIAGGSWSTKLLG------YFHREWGTYPVKGEVVA--VKSRKQLLKAPIF 247 Bacillus...
O31616              172 TPVLHVERDGE-ALFIKTPSG-DVWANHVVVASGVWSGMFFK------QLGLNNAFLPVKGECLS--VWNDDIPLTKTLY 241 Bacillus...
Q55710              167 VTVQAIAQRHGqVTAVLTDQG-SFQADSYVLANGSWAKELLP------LPVFPVKGQMMALRMPA--GTHQPYPLQRVLF 237 Synechoc...
BAC18744            173 ----------ErATAIP-------DDEQVVLANGLGAGQLHp-----gLQLRPVYGDILRLGVPDhlAPLLTRVVRGFVE 230 Coryneba...
CAE48542            172 ----------EkITDLEPLY---QQFDVVVLAAGLGAQHLSpi----pLALRPVRGDILRVQTe---PGAVNMVVRGWVN 231 Coryneba...
CAD93286            174 ------------VSSLS-----DVDAHTVVIANGIDAPALWp-----gLPIRPVKGEVLRLRWRPgcMPLPQRVIRARVR 231 Mycobact...
lhbprmlnih:CBU_0331 172 -----VESVVPyRILTKGKS---YQFDCIFDCRGTGAGEMFS------D-LRSVRGELIYLHAP---DVRLNRPIRLLHP 233 Coxiella...
O34292              151 -----EDARMRlTLGVVGESD--VDHDRVVDCTGAAQIGRLP------G-LRGVRGEMLCVETT---EVSLSRPVRLLHP 213 Rhizobiu...
CAD84561            173 CEVQELEISGQkVHAIRTPSE-KHSADQYILSAGAWSRKILGeha-lnLAIKPIRGQMLLYRLP-------GNPLCSIVL 243 Nitrosom...
WP_010897599        172 VGHISIEAWMEhQVLRGPSGK-QWAGDRLIVCAGAWASEHEE------TFSLRVPVYPIRGQICA--YEVPAGDVRHIVY 242 Bacillus...
CAD55293            190 WAERLTVGRGDrATGVVGADGtALEAGQVVLAGGSLSGRLGGvpeavlPPVRPVKGQVLRLTMPRtpGPLLNRTVRAVVR 269 Streptom...
WP_010880422        171 DAVKILRN-GErIEKVFGFFE-EFTADYYVFATGAWLKEHFG------FPVFPVKGQILRVEAP---------LKDYVVY 233 Aquifex ...
1RYI_A              255 HDHCYIVPRKSGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAGLRPGTKDGKPYIGRHPEDSrI 334 Bacillus...
tigr:GBAA_0730      248 QERFYIAPKRGGRYVIGATMKPHTFNKTVQPESITSILERAYTILPALKEAEWESTWAGLRPQSNHEAPYMGEHEEIKgL 327 Bacillus...
O31616              242 HDHCYIVPRKSGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAGLRPGTKDGKPYIGRHPEDSrI 321 Bacillus...
Q55710              238 GPQTYLVPRRDGRLIVGATSEQVDWQPHNTPQGIQTLLGRAIRLFPALGDWAIEDFWWGFRPGTPDEQPFLGYGPCDN-L 316 Synechoc...
BAC18744            231 DRTVYLIPRTDGTLAIGATSREDERP-VPRAGAVHDLLRDATRLAPGIKECDFLEATTGARPGTPDDLPYLG-RVDER-L 307 Coryneba...
CAE48542            232 DRPIYIIPRANGEIAIGATSREDERD-LPSVEGIYDLLRDAIRVVPGIVDSSLIEANVGVRPGTPDDLPYLG-WASDR-L 308 Coryneba...
CAD93286            232 GRQVYLVPRSDG-VVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEYELAECEAGLRPMTPDNLPLVQ-RLDSR-T 308 Mycobact...
lhbprmlnih:CBU_0331 234 RYRLYIVPRAHHIYLIGASEIESNDISPISVRTCLELLSAVYSVHPAFAEARIIETVTALRPALSDNLPRIH---YQPgL 310 Coxiella...
O34292              214 RHPIYIVPRDKNRFMVGATMIESDDGGPITARSLMELLNAAYAMHPAFGEARVTETGAGVRPAYPDNLPRVT---QEGrT 290 Rhizobiu...
CAD84561            244 QRDLYLIPRRDGHLLVGSTIEDTGFDKQITLDAKNRLSSWAEEILPQLKNTPLLKHWSGLRPATPDNIPIIGPHPFLEnL 323 Nitrosom...
WP_010897599        243 TSQGYIVPKGNGTVVNGASEDIAGYDTTVTEQGIKRLTNWNGHIFPFLNELTPFHTWAGLRPATQDGYPMIGETKKAPhV 322 Bacillus...
CAD55293            270 GNHVYLVPRESGELVVGATSEELGWDTTVTAGGVYELLRDAHELVPGITELPLTETRAGLRPGSPDNAPLLGPTALDG-L 348 Streptom...
WP_010880422        234 SSRAYIIPREKD-LLIGATTENAGFDTKTTLEGVKKLSEGAISSVPQLKEAQLLEVRVGFRPGTPDELPVFYFGENFS-- 310 Aquifex ...
1RYI_A              335 LFAAGHFRNGILLAPATGALISDLIMNKE 363 Bacillus subtilis
tigr:GBAA_0730      328 YACTGHYRNGILLSPVSGQYMADLIEGKQ 356 Bacillus anthracis str. 'Ames Ancestor'
O31616              322 LFAAGHFRNGILLAPATGALISDLIMNKE 350 Bacillus subtilis subsp. subtilis str. 168
Q55710              317 ILAIGHYRNGILLAPITAALISDLILDQK 345 Synechocystis sp. PCC 6803 substr. Kazusa
BAC18744            308 IISTGYFRHGILLTALAAEATLAMVEHRD 336 Corynebacterium efficiens YS-314
CAE48542            309 IISTGYFRHGILLSALGAHVTACLIDGTD 337 Corynebacterium diphtheriae
CAD93286            309 LVAAGHGRSGFLLAPWTAEQIVSELVSVG 337 Mycobacterium bovis AF2122/97
lhbprmlnih:CBU_0331 311 IAINGLYRHGFLVAPALIDEVIHNLSRGI 339 Coxiella burnetii RSA 493
O34292              291 LHVNGLYRHGFLLAPAMAGEVARRLLTEQ 319 Rhizobium etli CFN 42
CAD84561            324 YINSGHFRYGVTMAPGSAEILVNEILKRT 352 Nitrosomonas europaea ATCC 19718
WP_010897599        323 VFATGHYRNGILLSPITAKVVADVVEGKK 351 Bacillus halodurans
CAD55293            349 LLATGHYRNGVLLTPVTGDVMAEALTGGE 377 Streptomyces coelicolor A3(2)
WP_010880422        311 -VYGGHYRNGILLAPATAEVALKLIDQGE 338 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap