1ZUN


Conserved Protein Domain Family
CysN

?
TIGR02034: CysN 
Click on image for an interactive view with Cn3D
sulfate adenylyltransferase, large subunit
Metabolic assimilation of sulfur from inorganic sulfate, requires sulfate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulfates. This pathway appears to be similar in all prokaryotic organisms. Activation is first achieved through sulfation of sulfate with ATP by sulfate adenylyltransferase (ATP sulfurylase) to produce 5'-phosphosulfate (APS), coupled by GTP hydrolysis. Subsequently, APS is phosphorylated by an APS kinase to produce 3'-phosphoadenosine-5'-phosphosulfate (PAPS). In Escherichia coli, ATP sulfurylase is a heterodimer composed of two subunits encoded by cysD and cysN, with APS kinase encoded by cysC. These genes are located in a unidirectionally transcribed gene cluster, and have been shown to be required for the synthesis of sulfur-containing amino acids. Homologous to this E.coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulfurase and APS kinase activity, yet are involved in Nod factor sulfation, and sulfation of other macromolecules. With members of the Rhizobiaceae family, nodQ often appears as a fusion of cysN (large subunit of ATP sulfurase) and cysC (APS kinase). [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 213679
View PSSM: TIGR02034
Aligned: 10 rows
Threshold Bit Score: 625.552
Threshold Setting Gi: 19554003
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZUN_B        25 LRFLTCGNVDDGKSTLIGRLLHDSKXIYEDHLEAITRDSKKSGTTGDDVDLALLVDGLQAEREQGITIDVAYRYFSTAKR 104
gi 11386737   22 LKFLTCGSVDDGKSTLIGRLLHDTKQIYDDQLFFLKSDSKRHGTQGNEIDLALVVDGLQSEREQGITIDVAYRYFSTNKR 101
gi 6093522    28 LRFLTCGSVDDGKSTLIGRLLSDTKQIFEDQLAALERDSRKHGTTGDDIDFALLVDGLEAEREQGITIDVAYRFFATPKR 107
gi 21105250   53 LRFITCGSVDDGKSTLIGRLLYDSKRLFDDQLAALESDSRRHGTQGESIDYALLMDGLAAEREQGITIDVAYRYFDTDRR 132
gi 54041625   10 LRFLTCGSVDDGKSTLIGRLLHDAGLISDDQLEQARRDSRGRAEEDGGIDFSLLVDGLEAEREQSITIDVAYRYFATDRR 89
gi 24528411   33 LRLITCGSVDDGKSTLIGRLLWDTKAVKEDQAASLQRDSKGKQNDLGLPDFALLLDGLQAEREQGITIDVAYRYFSTDKR 112
gi 489344654  25 LRFLTCGNVDDGKSTLIGRLLHDSKMIYEDHLEAITRDSKKVGTTGEEVDLALLVDGLQAEREQGITIDVAYRYFSTAKR 104
gi 499221816  25 LRFITCGSVDDGKSTLIGRLLYDSKMIFEDQMAALEVDSRKVGTQGGAIDFALLVDGLAAEREQGITIDVAYRFFSTEKR 104
gi 489959468  19 LRLCTAGSVDDGKSTFVGRLLHDTKSVLADQLASVERTSADRGFEG--LDLSLLVDGLRAEREQGITIDVAYRYFATDKR 96
gi 29336700   28 LRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKR 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZUN_B       105 KFIIADTPGHEQYTRNXATGASTCDLAIILVDARYGVQTQTRRHSYIASLLGIKHIVVAINKXDLNGFDERVFESIKADY 184
gi 11386737  102 KFIIADTPGHEQYTRNMATGASTCDLSILLVDARKGLSEQTYRHSFISTLLGIKYLIVAINKMDLVNYKQEIFENIKKDF 181
gi 6093522   108 KFIVADTPGHEQYTRNMATGASTADLAIVLIDARQGVLRQTRRHSIIASLLGIRHIVLAVNKIDLVGFDQAVFERITESY 187
gi 21105250  133 KFIVADCPGHEQYTRNMATGASTADVAVVLVDARKGLLAQTRRHSYIVSLLGIRHVVLAVNKMDLVDYDAQVFADIAQGY 212
gi 54041625   90 SFIVADAPGHEQYTRNMATAASGASLAVLLVDARKGLLTQTRRHAIVASLMGIRHVVLAVNKMDLVEDGETVFAAIRQAF 169
gi 24528411  113 SFIVADTPGHEQYTRNMATGASTADLAVLLVDARVGLLEQTRRHATIATLMGIKQFVLAVNKIDLTDYDRSRFEQISHEF 192
gi 489344654 105 KFIIADTPGHEQYTRNMATGASTCDLAIILVDARYGVQTQTRRHSYIASLLGIKHIVVAVNKMDLKGFDEGVFESIKADY 184
gi 499221816 105 KFIVADTPGHEQYTRNMVTGASTADAAVILIDARKGVLTQTRRHSYLVSLLGIRHVVLAVNKMDLVGWDKGVFDAIVADY 184
gi 489959468  97 TFILADTPGHVQYTRNTVTGVSTSQVVVLLVDARHGVVEQTRRHLSVSALLGVRTVILAVNKIDLVDYSEEVFRNIEKEF 176
gi 29336700  108 KFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDYSEETFTRIREDY 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZUN_B       185 LKFAEG--I-AFKPTTxaFVPXSALKGDNVV-NKSERSPWYAGQSLXEILETVEIAS-D-RNYTDLRFPVQYVNRPNL-N 257
gi 11386737  182 LIFSKK--LaNDLNII--FIPMSALLGENIV-FKTKLMPWYQGVTLLSFLETIKIKN-S-ISSEELRFPVQYINRPNS-D 253
gi 6093522   188 RQFSRD--L-GFQTIV--PIPMSARYGDNVT-SRSESMEWYSGPTLIEHLETVSVEE-A-VVELPFRFPVQYVNRPNL-D 258
gi 21105250  213 AALAAQ--L-GIADVQ--CIPLSALAGENLS-SASTRMPWYSGPHLLQHLDTVQLEP-P-EAGSGLRLPVQWVNRPNA-Q 283
gi 54041625  170 TVFSAP--L-GFRSVT--AIPLSARHGDNVV-HRSAAMPWHHGPTLLGHLETAAAED-DpTEDGPLRFLVEWVNRPNL-D 241
gi 24528411  193 KELALS--L-GVRQVT--AIPVSALKGENVVyDGRASMPWYEGPTLIEVLE-LATTR-S-AQTVGFRLPVQRVSRPGE-S 263
gi 489344654 185 LKFAEAinL-TPSSLH--FVPMSALKGDNVV-NHSEQSPWYAGPTLMEILETVEVSA-D-RNFTDLRFPVQYVNRPNL-N 257
gi 499221816 185 RAFAEQ--I-GLSVFT--PIPISGLGGDNMA-TRSDATPWFEGPILMDWLEAVEVED-D-LQAKPFRMPVQWVNRPNL-D 255
gi 489959468 177 VGLASA--L-DVTDTH--VVPISALKGDNVA-EPSTHMDWYTGPTVLEILENVEVSHgR-AHDLGFRFPIQYVIREHAtD 249
gi 29336700  188 LTFAGQ--LpGNLDIR--FVPLSALEGDNVA-SQSESMPWYSGPTLLEVLETVEIQR-V-VDAQPMRFPVQYVNRPNL-D 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZUN_B       258 FRGFAGTLASGIVHKGDEIVVLPSGKSSRVKSIVTFEGELEQAGPGQAVTLTXEDEIDISRGDLLVHADNVPQVSDAFDA 337
gi 11386737  254 FRGYSGILLSGRMHVGQTIKILPENINSRVSRIVTFDKELKKAEIGESITVVLKDEIDINRGDFFVNIDSILQPSQEAII 333
gi 6093522   259 FRGFAGTVASGSVAPGDEVVVAKSGKSSRVKRIVSYGGDLAQAAAGQAVTLVLDDEVEISRGNMLVSPAARPQVADQFAA 338
gi 21105250  284 FRGYAGTIAAGQVQVGDAVVVVPSGRRTQVARVLDANGEVDSARAGQAVTLTLRNEIDISRGDIIAAVDDPPEVADQFAG 363
gi 54041625  242 FRGLSGTLLSGSLETGGAVTVWPSGRSARIARIVTFDGDVTQARAGDAVTVTLDAAVDAGRGDLLSGPDGAPEVADQFAA 321
gi 24528411  264 FRGYQGTVAGGSVKPGDSVVILPSGMVANVTKIVTFDLVRNAAVAGDAITLVLDRQVDVSRGDLIAAIDSQPMTGLAFDA 343
gi 489344654 258 FRGFAGTIASGVVHKGDEIVVLPSGKSSRVKSIVTYEGELENAGPGQAVTLTMEDEIDISRGDLLVHADNVPPVTDQFDA 337
gi 499221816 256 FRGFSGLIASGSIKPGDRIRALPSGRESRVARIVTLPGDLDQAVAGQSVTLTLEDEIDISRGDVIAAADAPAPVANQFEA 335
gi 489959468 250 YRGYAGTINAGSVSVGDTVY-LPEGRTTQVTHIDSADGSLQTASVGEAVVLRLAQEIDLIRGELIAGEDR-PESVRSFNA 327
gi 29336700  260 FRGYAGTLASGRVEVGQRVKVLPSGVESNVARIVTFDGDREEAFAGEAITLVLTDEIDISRGDLLLAADEALPAVQSASV 339
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZUN_B       338 XLVWXAEEPXLPGKKYDIKRATSYVPGSIASITHRVDVNTLEEGPASSLQ-LNEIGRVKVSLDAPIALDGYSSNRTTGAF 416
gi 11386737  334 DIVWMTDNILLAGESYNVKLSGKKIRVYIKEILFKLDVNTLKKVKSHSLV-LNSIGRVKIYFSKPVIFDNYSENRMTGNM 412
gi 6093522   339 NIVWFDEHALLPGRSYILRTETDQTSATVTDLKYRINVNDFAHEAAKSLE-MNEVGICNISTRSPIAFDTFAENRTTGAF 417
gi 21105250  364 HLLWMDDAALLPGRPYWLKIGTRTVTASISEIKHKVDVNTQERLAAKRLE-LNEVGYCNLALDEPIAFSPYARNRVLGGF 442
gi 54041625  322 HLLWMAEEPLIPGRSYLLRAGARWVPATVTALRHAVNVETLEHGAASVLG-LNAVGLCNLSTAAPLAFDPYEASRHTGSF 400
gi 24528411  344 QLVALQAEGIQPGKRYWLKSGSRRQRVQVQPIS-QLDLKSGKWNHADELP-MNAIGKVHLSFDEQAVFDAYEQNRTTGAF 421
gi 489344654 338 MLVWMAEEPMLPGKKYDIKRATSYVPGSIASITHKVDVNTLEQGAASALQ-LNEIGRVKVALDTSIALDGYDSNRTTGAF 416
gi 499221816 336 TLVWMDDEPLPPGRTYLLKLGARTVGASITDIKHRVNVNTLEKTAAKRLE-LNEIGVCNLSLDQAIPFEAYAENRHMGGF 414
gi 489959468 328 TVVGLADRTIKPGAAVKVRYGTELVRGRVAAIERVLDIDGVNDNEAPETYgLNDIAHVRIDVAGELEVEDYAARGAIGSF 407
gi 29336700  340 DVVWMAEQPLSPGQSYDIKIAGKKTRARVDGIHYQVDINNLTQREVENLP-LNGIGLVDLTFDEPLVLDRYQQNPVTGGL 418
                        410
                 ....*....|....*.
1ZUN_B       417 IVIDRLTNGTVAAGXI 432
gi 11386737  413 IFIDLLTNITVGAGMI 428
gi 6093522   418 ILIDRITNATVGAGMI 433
gi 21105250  443 ILIDRQSNATVAAGTL 458
gi 54041625  401 ILVDRFSNRTVGAGMI 416
gi 24528411  422 ILIDPDTNNTVAGGMI 437
gi 489344654 417 IVIDRLTNGTVGAGMI 432
gi 499221816 415 ILIDRLSNRTVGAGLI 430
gi 489959468 408 LLIDQSSGDTLAAGLV 423
gi 29336700  419 IFIDRLSNVTVGAGMV 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap