4KDC


Conserved Protein Domain Family
UbiG

?
TIGR01983: UbiG 
Click on image for an interactive view with Cn3D
ubiquinone biosynthesis O-methyltransferase
This model represents an O-methyltransferase believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and fungi (COQ3). A separate methylase (MenG/UbiE) catalyzes the single C-methylation step. The most commonly used names for genes in this family do not indicate whether this gene is an O-methyl, or C-methyl transferase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 273910
View PSSM: TIGR01983
Aligned: 16 rows
Threshold Bit Score: 324.248
Threshold Setting Gi: 7673983
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KDC_A        22 EIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGG---------------------------LF------------ 62
gi 313104241  96 EVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIRDNLLKtipnh-----------------qpgkpLL------------ 146
gi 3881187    32 EVEKFGDLSAEWADELGPFHALHSLNRIRVPWIVDNVRKsdqk------------------------------------- 74
gi 21264383   80 ELAKFSAIADTWWHSEGPFKPLHQMNPTRLAFIRSTLCRhfskdp----------------ssakpFE------------ 131
gi 17368584   13 EVERFSALAAEWWNPNGKFRPLHKFNPVRLSYIRDQIAArfgrdp----------------raarpFE------------ 64
gi 27348461   19 EIAKFSKLSAEWWDPKGKMAPLHRINPLRLGYIRDAACRkfernv----------------rslncLG------------ 70
gi 29540962   12 ELAKFSDLAQDWWNPAGKMKPLHLINPVRLKYIEQQIT----------------------------LK------------ 51
gi 7674407     8 ELEKFEKISHNWWNKNGEFGILHRINHIRIEYIIEKIKSny-----------------------ndIS------------ 52
gi 92090588   40 EVKHFQELAPTWWDTDGSQRILHKMNLTRLDFVQRTVRNqvkiqnpeifvpgfnykeflpeyvcdnIQremqesietnld 119
gi 499265136 161 EISKFAKMAGQWWDENGKFKPLHIMNPVRVSYIIEKIKElkk----------------------cnLK------------ 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KDC_A        63 ---GKKVLDVGCGGGILAESMAREGAT--VTGLDMGFEPLQVAKLHALESGIq-------VDYVQETVEEHAAKh--aGQ 128
gi 313104241 147 ---GMKILDVGCGGGLLTEPLGRLGAS--VIGIDPVDENIKTAQCHKSFDPVld----krIEYRVCSLEEIVEEt--aET 215
gi 3881187    75 --appRLVDVGSGGGLLSIPLARSGFD--VTGIDATKQAVEAANQSLTAKPLqiagiskrLRFEHTSVEDFCQKphnkSA 150
gi 21264383  132 ---GLKFIDIGCGGGLLSEPLARMGAT--VTGVDAVDKNVKIARLHADMDPVts-----tIEYLCTTAEKLADEg--rK- 198
gi 17368584   65 ---GLRILDIGCGGGLLCEPMARLGAE--VVGADASETNIEVAKLHAAEGNVi-------VDYRATTAEDLADAg--eT- 129
gi 27348461   71 ---GLRVLDIGCGAGLLCEPLSRLGAQ--VIGVDPSQSNIAAAKLHADKSHLa-------IDYRCTTVEEIDPRe---R- 134
gi 29540962   52 ---GKHVLDVGCGGGLLSEALAKHGAI--VTGVDMSESLIDVAKNHAEQQQLn-------INYQCQDIEILTKDa---QR 116
gi 7674407    53 ---KLQILDVGCGGGLIAAPLALQGFN--VTAIDALKSNVETATIYAQKNGLk-------INYLQATIEELENDk---L- 116
gi 92090588  120 krpEVSVLDVGCGGGILSESLARLKWVknVQGIDLTRDCIMVAKEHAKKDPMle----gkINYECKALEDV--T----GQ 189
gi 499265136 207 ---ELSLLDVGCGGGILSESMARVGIN--VVGIDVCEENIKVAHSHAKKVGLn-------IEYIHTSIEELSNDk----k 270
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KDC_A       129 YDVVTCMEMLEHVPDPQSVVRACAQLVKPG-GDVFFSTLNRNGKSWLMAVVGAEYILRMVPKGTHDVKKFIKPAELLGWV 207
gi 313104241 216 FDAVVASEVVEHVIDLETFLQCCCQVLKPG-GSLFITTINKTQLSYALGIVFSEQIASIVPKGTHTWEKFVSPETLESIL 294
gi 3881187   151 YDAVVASEIVEHVADLPGFIGCLAELARPG-APLFITTINRTWLSKLAAIWLAENVLKIVPPGVHDWEKFITPAELTSHL 229
gi 21264383  199 FDAVLSLEVIEHVANPAEFCKSLSALTIPN-GATVLSTINRTMRAYASTIVGAEYILRWLPKGTHQWSSFVTPEEMSMIL 277
gi 17368584  130 FDVILNMEVVEHVADIDLFVAKCGQMVRPG-GIMFVATINRTLKALGLAIIGAEYVLRWLPRGTHQFGKLVRPEELEKAL 208
gi 27348461  135 FDIVLAMEVVEHVVDVGVFLKRCAAMLKPN-GLMVVSTLNRNWKSFALAIVGAEYVLRWLPRGTHEWNKFVTPDELTKYL 213
gi 29540962  117 FDIITCMELLEHVPDPQRMIKNCAALIKPG-GKLFFSTINRNFKAYLYTIVGAEYVFNLLPKGTHDYAQFIRPSELTQWA 195
gi 7674407   117 YDVVICLEVIEHVANIQQFILNLVQHIKPN-GIAIISTMNRTKKAYLFGIIVAEYILGWVPKNTHDYSKFVKPSEIYEIL 195
gi 92090588  190 FDIITCMEMLEHVDMPSEILRHCWSRLNPEkGILFLSTINRDLISWFTTIFMGENVLKIVPKGTHHLSKYINSKEILAWF 269
gi 499265136 271 YDVVLLMEVVEHVDNLELFMKKAIELLKPE-GLIFISTINRTIKSFCLAIIGAEYILNWLPKGTHNWNKFLKPSEIANHL 349
                        250       260       270
                 ....*....|....*....|....*....|....*.
4KDC_A       208 D---QTSLKERHITGLHYNPITNTFKLGPGVDVNYM 240
gi 313104241 295 E---SNGLSVQTVVGMLYNPFSGYWHWSENTSLNYA 327
gi 3881187   230 E---KAGCRVTAVHGLMFHPVGNHWTWIESTQCNYG 262
gi 21264383  278 Q---RASVDVKEIAGFVYNPITGRWLLSDDISVNYI 310
gi 17368584  209 G---GASLTIIDRTGVTYNPLADRWARSKDMDVNYM 241
gi 27348461  214 L---DNRLVITEQTGVVYSPFADKWTLSSDMDVNYM 246
gi 29540962  196 E---SGGLRLLDITGIHYHPLKNEFDLSRDVSVNYL 228
gi 7674407   196 T---DTNIEIKELKGLVFNLAKNEWKLSNDIDVNYF 228
gi 92090588  270 NdnySGQFRLLDLKGTMYLPYQGWVEHDCSDVGNYF 305
gi 499265136 350 R---ENNVTLQNMAGMEYNVIKREWNLTKGVDVNYI 382
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap