2D3W


Conserved Protein Domain Family
sufC

?
TIGR01978: sufC 
Click on image for an interactive view with Cn3D
FeS assembly ATPase SufC
SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic () or associated with the membrane (). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 273907
View PSSM: TIGR01978
Aligned: 16 rows
Threshold Bit Score: 372.749
Threshold Setting Gi: 490683500
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D3W_A         2 LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIF 81
gi 26454210    4 LTIENLHVSINEKEILKGIDIEVNKGEVVALLGPNGHGKSTLLKAIMHHYTTEITDGSIKVDGQDTAELETDEIARLGLF 83
gi 3025252     2 LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIF 81
gi 499222188   2 LKIQNLHARVEDKPILRGVTLDVPAGEVHAIMGPNGAGKSTLSYVLTGRDGYEVTEGSASLNGEDLLALEPNERAAKGLF 81
gi 499382592   2 LLIENLIVKIGDQNILNNLNLEIKKGEIHAIMGPNGSGKSTLSDTLAGKKNCIICSGRILFKKIDISQLNPEERAGNGIF 81
gi 504318451  37 LDIRDLCMSIADRPILKSLNLTLNTGEVHAVMGPNGAGKSTLAGTIVGNPHCTIERGEIYFQGQCINDVPVYERARRGIF 116
gi 497557876   2 LHLCDVHVCCEEKKILEGLSLSIHPGELHIIMGPNGAGKSTLAKVLSGDESVEVSSGTMTLAGQDLLELSPEERAHAGMF 81
gi 499336787   6 LEIKDLHVEVEDKHILKGLNLTIKKGEIHAIMGPNGSGKSTLCHAIMGNPRYRITGGEILFEGENITNLKVNERAKKGIF 85
gi 499185789   2 LKIKHLHASCNDVKILDDFNLNIQPGTMHVIMGPNGAGKSTLAKILAGDESVLVSSGEIALQEQNLLSMLPEERSRAGLF 81
gi 499269169   6 LQINNIHAEADGKEILKGLDLTVGKGEIHIVMGPNGAGKSTLMNVIMGHPKYKITNGNINFEGEDITDLKTDERARKGIF 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D3W_A        82 MAFQYPVEIPGVSNQFFLQTALNAVRsyrgQETLDRFDFQDLMEEKIALLKMPE---DLLTRSVNVGFSGGEKKRNDILQ 158
gi 26454210   84 LAPQHSEEIPGVTMLDFLRSVLNARS----EEKLKLSQYFPVFEQNLKSMGLDR---EYLNRFVNYGFSGGEKKKCEILQ 156
gi 3025252    82 MAFQYPVEIPGVSNQFFLQTALNAVRsyrgQETLDRFDFQDLMEEKIALLKMPE---DLLTRSVNVGFSGGEKKRNDILQ 158
gi 499222188  82 LSFQYPLEIPGVPALTFIRTALNAQRrargEDEIAAPAFLKLAKEKAASLKIDF---EMLKRGLNVGFSGGEKKRMEIFQ 158
gi 499382592  82 IAYQYPVEIPGISNKRFLHASVNAIRkyknKPPLDMFNFSEIFKKNISLLNMPE---NLIHRSLNTGFSGGEKKRNEILQ 158
gi 504318451 117 LSFQTPEEVPGLSVEEFLRAAKEAVLg----TKVSVLDFHTQLRAKLARLRISE---AYASRGLNVGFSGGEKKKNEILQ 189
gi 497557876  82 ISFQHPLEIPGVNNRIFLKEACNACRkarnQAVLDDAAFEELLTDLEEVYGFPGf-hFFSNRNVNEGFSGGEKKKNELWQ 160
gi 499336787  86 LSFQSPEEIPGITVDNFIRTSSTIVTgq----nMSMLQFAKEMQKMLELLDMSA---EYRTRYLNVGFSGGEKKKTEVLQ 158
gi 499185789  82 VGFQMPPEIPGVNNKMFLRDAYNARRranqEGDISIDEFNTLLSTVLETYEYNAttdLFLDRNVNEGFSGGERKRNEICQ 161
gi 499269169  86 LSFQNPEEVAGITASDLIRS---ARTqaegK-PIKLMAFRKELKEKMALLEMNE---SYSERDLNVGFSGGEKKKNEILQ 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D3W_A       159 MAVLEPELCILDESDSGLDIDALKVVADGVNSLRD--GK--RSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVK 234
gi 26454210  157 MKIIQPDFVLLDEIDSGLDIDSLKMVVDQINNWKS--ED--KALIVVSHHENLFKKIIPNRVYVIIDGKIAISGGVEIYE 232
gi 3025252   159 MAVLEPELCILDESDSGLDIDALKVVADGVNSLRD--GK--RSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVK 234
gi 499222188 159 MSMLSPKFLILDETDSGLDIDALKIVSEGVNALRS--PE--RGMLVITHYQRLLDHIKPDKVHVLAAGRIVASGGPELAL 234
gi 499382592 159 MMMIKPDLCILDEIDSGLDIDSLREITNCINLLKS--KK--RSFIIITHYQRILNYINPDYVHILHKGNIIQSGKFDLVK 234
gi 504318451 190 LAVLEPKLAILDETDSGLDVDATRIVFEGIDDIRT--PD--MGFLIITHHREVLEYIKPDVVHILVDGTIVKTGDVSLVH 265
gi 497557876 161 MLALEPKMVVLDEPDSGLDVDALKGICSVLQRYRQ--QHpeTAFCIITHNPRLGDLLQPDHVHILLNGRVVFSGDMHLME 238
gi 499336787 159 MAFLKPKLVMLDEIDSGLDIDALKVVAETIKKLKT--ED--MAILVVTHYNRILNYLEPDVISVLMDGKIVKEGDKELAR 234
gi 499185789 162 MLVLEPEMVLLDEPDSGLDVDALRLICRVLEKYRElhPT--SSLCIVTHNPKLGNLIRPDVVHLLLDGRVALSGDVSLMH 239
gi 499269169 159 MLMLNPKLAILDETDSGLDVDAVKIVSEGISKFKN--EN--NSLLIITHNSKILESLKPDFVHVLLDGKIVKDGDISLMN 234
                        250
                 ....*....|
2D3W_A       235 QLEEQGYGWL 244
gi 26454210  233 RINREGYKWV 242
gi 3025252   235 QLEEQGYGWL 244
gi 499222188 235 QLEAEGYDRI 244
gi 499382592 235 QLEKHGYGWI 244
gi 504318451 266 YVVEHGYADF 275
gi 497557876 239 ELERKSYQEL 248
gi 499336787 235 ILEEKGYDFV 244
gi 499185789 240 ELEAKSYQEV 249
gi 499269169 235 EINTKGFVDF 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap