Conserved Protein Domain Family
nuoF_fam

?
TIGR01959: nuoF_fam 
NADH-quinone oxidoreductase, F subunit
This model describes the F chain of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoF. This family does not have any members in chloroplast or cyanobacteria, where the quinone may be plastoquinone and NADH may be replaced by NADPH, nor in Methanosarcina, where NADH is replaced by F420H2. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131014
View PSSM: TIGR01959
Aligned: 11 rows
Threshold Bit Score: 725.28
Threshold Setting Gi: 117926904
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506953    12 PLTWRLR--DdK-QPVWLDEYRSKN---GYEGARKALTG-LSPDEIVNQVKDAGLKGRGGAGFSTGLKWSLMPKDES--- 81
gi 25008857   12 PLTWRLR--NdR-ETVWIEEYCKKN---GYFSLKKALKT-MCPEDVVHLIKESGLKGRGGAGFSTGLKWSLMSKDNS--- 81
gi 7387967    11 VISRHWD--D-P-ESWTLATYQRHDryrGYQALQKAL-T-MPPDDVISIVKDSGLRGRGGAGFATGTKWSFIPQGDTgaa 84
gi 7387963     7 RIFTNIY--G-L-KDKSLRGAMARG---HWDGTKQFLEK--GRDWIINEVKASGLRGRGGAGFPTGLKWSFMPKESd--- 74
gi 7387969     7 KIFTNLY--G-Q-QSYDLKSSQKRG---DWYNTKALIDK--GRDFIIDEVKKSGLRGRGGAGFSTGMKWSFMPKNS---- 73
gi 17380453    5 VLLRNVD--V-P-DGHLLSTYEAGG---GYRALRKALGE-YTPDEIVELVKESNLRGRGGAGFPTGMKWSFVPKAAg--- 73
gi 499257361  20 PLTWRLR--D-DgEPVWLAEYESKN---GYAAARKALAQ-MSADDIVQSVKDSGLKGRGGAGFPTGVKWGLMPKDES--- 89
gi 504386628   8 VIFDQVDtaN-P-DCWTLDEYVKRG---GYTALRKILSEnISQTDVIDEVKTSGLRGRGGAGFPTGLKWSFMPRSF---- 78
gi 446752228   6 LLTKYID--N-P-QSTKLEFYESVH---GYDGMKKALQ--MKPDDIIAEVKKSGLRGRGGAGFPTGLKWSFIPKDI---- 72
gi 499348361  20 VVYTTLH--Y-D-TPWSYESYLKTG---GYAALRKILEEkIPPGDVIEMVKASNLRGRGGAGFPTGLKWSFMPKG----- 87
gi 500034451   7 VLFKNIH--I-Q-GQNTLAVAQQQG---AYKRMEKALG--MSGEEIIQEVKSAGLRGRGGAGFPAGLKWSFIPKDD---- 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506953    82 MNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEA-AVNLRRAIAEATEAGLLGKNI 160
gi 25008857   82 SKIRYLLCNADEMEPGTYKDRFLMENIPHQLIEGMLLSAFALNVSRGYIFLRGEYIKA-EYILKKSIQEAINFGFIGSNI 160
gi 7387967    85 AKPHYLVVNADESEPGTCKDIPLMLATPHVLIEGVIIAAYAIRAHHAFVYVRGEVVPV-LRRLHNAVAEAYAAGFLGRNI 163
gi 7387963    75 GRPHYLVVNADESEPGTCKDRDIMRHDPHTLIEGCVIASFAMGAHAAYIYVRGEFIRE-REALQAAIDECYEYGLLGKN- 152
gi 7387969    74 EKPCYLVVNADESEPGTCKDRDILRFEPHKLIEGCLIASFAIGANTCYIYIRGEFYNE-ASNMQRALDEAYKEGLIGKNA 152
gi 17380453   74 -KPKYLCCNADEGEPGTFKDRIIMERDPHQLIEGLAVSAYAIGAETAYVYIRGEYVTA-IRRMEQAIAEAHENGYLGIGI 151
gi 499257361  90 MNIRYLLCNADEMEPNTWKDRMLMEQQPHLLVEGMLISARALKAYRGYIFLRGEYTTA-AKNLNRAIDEAKAAGLLGKNI 168
gi 504386628  79 PGEKYVVCNTDEGEPGTFKDRDIIMFNPHALIEGMIIAGYAMGAKAGYNYIHGEIFEG-YQRFEAALEQARAAGFLGKNI 157
gi 446752228  73 PKPKYIICNADEGEPGTFKDRKLIENLPHQIIEGMIIGARAIGSNKGFFYIRGEFQKG-AKAMQAAIDEAYSKGYLGKNI 151
gi 499348361  88 TMQKYILCNSDESEPGTCKDRDILRYNPHSVVEGMAIACYATGSTVGYNYLRGEFHHEpFENFELALADAYANGWLGKNI 167
gi 500034451  74 PRPKYLVCNADEGEPGTCKDRDLMRFDPHLLIEGMIIAGYAVNSKQGYIYIRGEFYRE-AEVLEAAVAEAYAANLLGKNI 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506953   161 MGTGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPATSGAWGKPTCVNNVETLCNVPAILANGVEWYQNIS 240
gi 25008857  161 LNSGFNFELFLHTGAGRYICGEETALINSLEGRRANPRAKPPFPAVFGLWGKPTCVNNVETLSNVPSIVLHGVNWYKKLS 240
gi 7387967   164 GGSGFDLELVVHAGAGAYICGEETALLDSLEGRRGQPRLRPPFPAVAGLYGCPTVINNVETIASVPSIILGGIDWFRSMG 243
gi 7387963   153 NKLGYDIDIYVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANMGLYGCPTTVNNVESIAVTPTILRRGAGWYTSFG 232
gi 7387969   153 CGSGFDCNIYLHRGAGAYICGEETALLESLEGKKGMPRLKPPFPAGFGLYGCPTTINNVESIAVVPTILRRGASWFAAIG 232
gi 17380453  152 LGSGFNFMVHIHRGAGAYICGEETAMLESLEGKRAQPRLKPPFPAVAGLYASPTVINNVETLACVPHIVMRGSAWFRGIG 231
gi 499257361 169 LGSGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPAAVGVWGKPTCVNNVETLCNVPAIVANGNDWYKSLA 248
gi 504386628 158 LGSDFEFELFAHHGYGAYICGEETALLESLEGKKGQPRFKPPFPASFGLYGKPTTINNTETFSSVPFIIRDGGQAFADKG 237
gi 446752228 152 LGSGFDFDLILYEGAGAYICGEETALINSLEGRRGHPRLKPPFPAVSGLYRSPTVVNNVETFSAIPHILDKGADWYSKIG 231
gi 499348361 168 LGSGVDIDIYGALGAGAYICGEETALMESLEGKKGQPRYKPPFPANFGLYGKPTTINNTETYASVPAIIRNGPEWFLGLS 247
gi 500034451 153 LGKGVDFDLAVHRGAGAYVCGEESALLNSLEGEKGQPRLKPPFPANVGLYGCPTVINNVETLCAVPAILEKGGAWYSKLG 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506953   241 -KS--KDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGL-K-FKAWQPGGAGTDFLT-EAHLDLPMEFESI 314
gi 25008857  241 kST--DTTGTKLMGFSGKVNNPGVWELPFGTTAREILEDYARGMKSGL-F-LKSWQPGGAGTDFLI-EKHLDLPMDFTSI 315
gi 7387967   244 s-E--KSPGFTLYSLSGHVTRPGQYEAPLGITLRELLD-YAGGVRAGH-R-LKFWTPGGSSTPLLT-DEHLDVPLDYEGV 316
gi 7387963   233 r-P--NNHGTKLYSVSGHVNRPCTVEDAMSIPFHELIEKHCGGIRGGW-DnLLAVIPGGSSVPCVPgAQMKDAIMDYDGL 308
gi 7387969   233 k-P--NNTGTKVFCISGHVNKPCNIEEVMGVPLKELIEKYAGGVRGGW-NnLKAIIPGGASVPLLPkSLCE-VEMDFDSL 307
gi 17380453  232 p-D--RSPGPKLYCLSGQVRKPGLYELPMGISLRELVEEHAGGPLPGR-K-VKAVIPGGVSAPVIP-EGELEVGMDFDSL 305
gi 499257361 249 -REgsEDHGTKLMGFSGKVKNPGLWELPFGVTARELFEDYAGGMRDGF-K-LKCWQPGGAGTGFLLpE-HLDAQMYAGGI 324
gi 504386628 238 -IP--NAGGTKLFCISGHVERPGNYEVPLGTPFAEVL-KMAGGMRGGK-K-LKAVIPGGSSAPVLPaDIMMQTNMDYDSI 311
gi 446752228 232 -TE--KSPGTRLFSVSGHVKKPGVYEIELGTPLLELVNDLCGGIIDDK-P-LKAIIPGGSSVPILTaEECKTANMDFESM 306
gi 499348361 248 -KT--KNGGPKIFSVSGCVQKGGNFEVPLGTTFDELLE-MAGGLRPGR-K-LKGVVPGGVSMPVLKaDQVAGLQMDYDTL 321
gi 500034451 233 -VE--KSSGTKLFSVSGHVNKPGNYEVELGIPLKSLINDYAGGVRGGWeN-LKGVIPGGSSTPVLIpEQCETILMSYEAL 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506953   315 GKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLG-P 393
gi 25008857  316 AKAGSRLGTAIAMAVDNKTNMISLVCNIEKFFSRESCGLCTPCREGLPWIVKILESLEKKEGHKNDVKNLERLCLDLS-P 394
gi 7387967   317 GAAGSMLGTKALEIFDETTCVVRAVRRWTEFYKHESCGKCTPCREGTFWLDKIYERLETGRGSHEDIDKLLDISDSIL-G 395
gi 7387963   309 RELGSGLGTAAVIVMDKSTDIIKAIWRLSAFYKHESCGQCTPCREGTGWMMRVMERMVQGRAQKREIDMLFDVTKQVE-G 387
gi 7387969   308 RTVGSGLGTGGIIVMDKSTDIIYAIARLSKFYMHESCGQCTPCREGTGWMWRVMMRLVNGNAKKNEIDTLLNVTKEIE-G 386
gi 17380453  306 TAAGSMLGSAGVVVIDDSTCMVKLATRIIEFFHHESCGKCTPCREGLDWTVKVLRRIEAGEGETGDLEQLEMLCKGIF-G 384
gi 499257361 325 AKVGTRMGTGLAMAVDDSINMVSLLRNMEEFFARESCGWCTPCRDGLPWSVKMLRALENGQGRAEDIETLLGLVNFLGpG 404
gi 504386628 312 SKAGSMLGSGAIIVMDEDVCMVKALERLSYFYYDESCGQCTPCREGTGWLYRIVHRIVEGKGKMEDLDLLDSVGNQMA-G 390
gi 446752228 307 AAHKTMLGSGAVIVLAEGTDIVETTYRFARFYAHESCGQCTPCREGTHWVRDILYKIREGEGTTEDIDLIFSLSRNMEgG 386
gi 499348361 322 RALGTGLGSGAIVVLDDSVCCVRFACRISQFFHKESCGQCTPCREGTGWMHRVLERIVAGKATMEDLHQLRTVAGQIE-G 400
gi 500034451 309 AGAGSMLGAGSVIVMDKSTCIVKAIARLSKFYRHESCGQCTPCREGTGWLAQIMDRIETGQGREGDIDLLLSVCSNIQ-G 387
                        410       420       430
                 ....*....|....*....|....*....|
gi 2506953   394 gKTFCAHAPGAVEPLQSAIKYFREEFEAGI 423
gi 25008857  395 gKTFCAHAPGAVEPLQSAIKYFRLEFEAGI 424
gi 7387967   396 -KSFCALGDGAASPVMSSIKHFRDEYLAHV 424
gi 7387963   388 -HTICALGDAAAWPIQGLIKHFRPEMEKRI 416
gi 7387969   387 -HTICALGDAAAWPIQGLIRHFRDEIEQRI 415
gi 17380453  385 -NTFCALGDGAAMGLRAALKHFRAEFVAHI 413
gi 499257361 405 -RTFCAHAPGAVEPLGSAIKYFRSEFEAGV 433
gi 504386628 391 -RTICALADAAVFPVRSFTKHFRDEFVHYI 419
gi 446752228 387 -TTICPLSDACVGAVRPALQKFRSEFDAKL 415
gi 499348361 401 -HTICAFGEAAAWPIQGFLRQFWDEFEYYI 429
gi 500034451 388 -KTICALGDAAAMPVVGAIRHFRDEFEYHV 416
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap