Conserved Protein Domain Family
rsbW_low_gc

?
TIGR01924: rsbW_low_gc 
serine-protein kinase RsbW
This model describes the anti-sigma B factor also known as serine-protein kinase RsbW. Sigma B controls the general stress regulon in B subtilis and is activated by cell stresses such as stationary phase and heat shock. RsbW binds to sigma B and prevents formation of the transcription complex at the promoter. RsbV (anti-anti-sigma factor) binds to RsbW to inhibit association with sigma B, however RsbW can phosphorylate RsbV, causing disassociation of the RsbV/RsbW complex. Low ATP level or environmental stress causes the dephosphorylation of RsbV.
Statistics
?
PSSM-Id: 273879
View PSSM: TIGR01924
Aligned: 4 rows
Threshold Bit Score: 257.803
Threshold Setting Gi: 499766310
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P17904         1 MKNNA-DYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAYKEDk-nGEVSIRFGVFEDRL 78  Bacillus subtil...
WP_010896706   1 MRVHQpETIEMTVPAKSEFVGVVRLTVSGIANRLGYTYDDIEDIKIAVAEACTNVVDHAYDEG---GTMGLSFHLYEDRM 77  Bacillus halodu...
WP_003721461   1 MATMH-DKITLQLPAKPEYVSLGRLSLSGIASRAGFSYEAIEDLKIAVSEAITNSVKHAFKGEe-dGEITVEYLIYEDKL 78  Listeria monocy...
WP_011447044  11 MQSKE-DFIEMRVPASAEYVSLIRLTLSGVFSRAGATYDDIEDAKIAVSEAVTNAVKHAYKENnnvGIINIYFEILEDKI 89  Staphylococcus ...
P17904        79 EVIVADEGDSFDFDQKQQDLGPYTPSHTVDQLSEGGLGLYLMETLMDEVRVQNHSGVTVAMTKYLNGERVDHDTT-IKNY 157 Bacillus subtil...
WP_010896706  78 EIIVTDQGQSFDMDAFRESLGPIDGSKPIQDLKEGGLGLFLINTLMDKVEMKEDSGVVLAMTKFLQRDEVDNRVDgISAT 157 Bacillus halodu...
WP_003721461  79 EVRVSDNGTSFDLETRKQEIGPYDVGEDAEMMRIGGLGLFLIETLMDDVKLYYDEGVSVVMTKYINEKQVEENA---KSI 155 Listeria monocy...
WP_011447044  90 KIVISDKGDSFDYETTKSKIGPYDKDENIDFLREGGLGLFLIESLMDEVTVYKESGVTISMTKYIKKEQVRNNG---ERV 166 Staphylococcus ...
P17904       158 ET 159 Bacillus subtilis subsp. subtilis str. 168
WP_010896706 158 QT 159 Bacillus halodurans
WP_003721461 156 ST 157 Listeria monocytogenes
WP_011447044 167 EI 168 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap