Conserved Protein Domain Family
Shik_kin_archae

?
TIGR01920: Shik_kin_archae 
shikimate kinase
This model represents the shikimate kinase (SK) gene found in archaea which is only distantly related to homoserine kinase (thrB) and not atr all to the bacterial SK enzyme. The SK from M. janaschii has been overexpressed in E. coli and characterized. SK catalyzes the fifth step of the biosynthesis of chorismate from D-erythrose-4-phosphate and phosphoenolpyruvate. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 273876
View PSSM: TIGR01920
Aligned: 8 rows
Threshold Bit Score: 265.037
Threshold Setting Gi: 14194472
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9YEK6         6 ASGGLTIVNAIGHGrLGGAAGLGLWVESRVREARglWAGVSLTPRGERrlppRVLEAAATAACSLGACVEGLEAEVHTGF 85  Aeropyrum perni...
Q58835         7 ALASGTIINAIATG-KGSAFGLDLKVYAKVKLIDdgKNKIEGKVLDNPnikpNLIVRCVKNTLDYFGLNYSAYVETKTEI 85  Methanocaldococ...
Q9HQB0         7 APAAGTVLNALATG-VGAAFALDIDTEASVSVTPs-ESGVSGEIAGHPeadtALVERCVSRVIDRYGDGQGGHVRTESEV 84  Halobacterium s...
Q8U0A5         7 GSSAITVVNAFATG-KGGAIGIDLWTEAKVKITd-gEVKGKILVNGLEfndfRVVNAVLDVMRRYSGIEFGIEFEINSEI 84  Pyrococcus furi...
WP_011008318   8 AYGGGTIINAIATG-HGAAFPISLRVAAEVCLSD--SPSVSTYADVDV----GPIYKILTRLGEKLGVG-PVSVRITGDL 79  Pyrobaculum aer...
WP_010922934  10 AYGGVSIVNALPSW-YGSSMAINLKVKVEIREGK--R----VYSQES-----ELIKTILNYFKEKYSIPD-IEVDIESEL 76  Sulfolobus solf...
WP_010917576   8 TNGGISILSAFIDG-LGGAFSIDLPLTATVYAG--------TRRRE---------DRLMEAIRSEFGIKDQLTYKVKSSI 69  Thermoplasma vo...
WP_010878027   6 AYAAGTVLNALPTG-IGSAFGIEMHTIVKLRPSD--E----LKVFVNG----VERRSIVAERILNSMDV-TAEVIVESEI 73  Archaeoglobus f...
Q9YEK6        86 PPGVGLKGSAALLASLVEAVLRLKG--VRAPPWRAALAAARVSRGAGLSVTGALDDHAASLLEAPVITDNRGMAILRLLP 163 Aeropyrum perni...
Q58835        86 PIKSGLSSSSATSNAVVLATFDALG--EKIDDELILNLGIKSSFDEKLTVTGAYDDATASYYGGITITDNIERKILKRDK 163 Methanocaldococ...
Q9HQB0        85 PLAAGLKSSSAAANATVLATLDALGvaDEVDRVDAARLGVQAARDAGVTVTGAFDDAAASMLGGVAMTDNREDDLLFRDA 164 Halobacterium s...
Q8U0A5        85 PVGKGLKSSSAVANALVEAIARALR--LNIPGIKVVKLGVEAAKKAGVTLTGAFDDACASYFGGLCLTDNLRVELLKRIE 162 Pyrococcus furi...
WP_011008318  80 PTAGGLKSSSATVNAIIIAMFKLAG--READLFNIARLNAELSKEAGISVTGAFDDAVASAVGRSYLTDNYKMIVLRELD 157 Pyrobaculum aer...
WP_010922934  77 PQKSGLKSSSAVSVALIAEIAKQYD--LRN--INPPILSAILSLKAGVSYTGALDDAVASYCGGIAFTYNKMFRIVKLEN 152 Sulfolobus solf...
WP_010917576  70 PAGYGLKSSSALVLALAKASLLYKS--VDIEDADLLVRLANISKAVGLSATGALDDLCQALYGGYCITDNKRMKIIKRGK 147 Thermoplasma vo...
WP_010878027  74 PGGSGLGSSSAFVNALICAVKKMKG--EELNAFEILRSNARFSLEAGISYTGAFDDASASMLGGFVVSDNRKMRLIRTDE 151 Archaeoglobus f...
Q9YEK6       164 RDGCrlTAVIGVPGvenPVENLDPSPFRRHSRLYDAAARLGLAGEWLPAMAVSGVAGALALGVEG-LASRLYEAGAAAAG 242 Aeropyrum perni...
Q58835       164 MRDDl-NVLILIPN---LEKNVDVNRMKLIKDYVEIAFNEAINGNYFKALFLNGILYASALNFPTnIAIDALDAGAITAG 239 Methanocaldococ...
Q9HQB0       165 VEWH---AAVWTPPeraYSADADVARCERVSGLAEHVAALAAAGDYGTAMTVNGLAFCAALDFPTaPAVTALPH-AAGVS 240 Halobacterium s...
Q8U0A5       163 IDELp--VVILVPNetvLTEELKGVDFLKIAPYVEEAFKLAIKGEWKKALVLNGLIYSTFLSYPPePISKALHLG-AVVG 239 Pyrococcus furi...
WP_011008318 158 VSG---RAVVLIPPyekRR--QRLEEMRAIAPVIRTAVAYAGLGMWREAMLINAVAYGYALGYPPePTLEALKLGA-VGG 231 Pyrobaculum aer...
WP_010922934 153 LEDN--LSILILAKg-gRQKPVNLNELRKYSHVFEEIFKIALK-DYLTAMKMNGILIANILGYSLePIEIALKKGALAAG 228 Sulfolobus solf...
WP_010917576 148 LPE----LAVLVCArgeTRPSRSINIRGNYFKVARSAENLAQRGFIFQAAVLNGFIYGTIFGIDLeTVRKIEENGANYAS 223 Thermoplasma vo...
WP_010878027 152 FEG---YSAVLIPKf--sRGKVDWRRLRERASEVEGAVEAAMRGEYCKAMKLNTEYICKMLGYPLeIAEKGWEKG-ICCG 225 Archaeoglobus f...
Q9YEK6       243 VTGKGPAVFALTERP--RG--AAEVLETAg-YEVVEA 274 Aeropyrum pernix K1
Q58835       240 LSGTGPSYIAMVEDEn-VE--KVKEKLNRy-GKVILT 272 Methanocaldococcus jannaschii DSM 2661
Q9HQB0       241 LSGTGPSYVAVGDEDgiEE--VSTRWHENp-GTVRET 274 Halobacterium sp. NRC-1
Q8U0A5       240 LSGKGPSVFAITDEP--ER--IEEVWREF--GDVIIT 270 Pyrococcus furiosus DSM 3638
WP_011008318 232 VSGTGPAHVFIAENP--EE--VAAALSKY--GRVYVV 262 Pyrobaculum aerophilum
WP_010922934 229 ISGNGPSYFAVSKNG--EEgpIYESLKKF--GDVIIV 261 Sulfolobus solfataricus
WP_010917576 224 QSGKGPAVFGLFTDP--SD--AKRAKMDIgfGIVTKI 256 Thermoplasma volcanium
WP_010878027 226 ISGNGPSYVAFGSKNemEA--LAETWGEY--GRVYVR 258 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap