3V4X


Conserved Protein Domain Family
HMG-CoA-S_prok

?
TIGR01835: HMG-CoA-S_prok 
Click on image for an interactive view with Cn3D
3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade
This clade of hydroxymethylglutaryl-CoA (HMG-CoA) synthases is found in a limited spectrum of mostly gram-positive bacteria which make isopentenyl pyrophosphate (IPP) via the mevalonate pathway. This pathway is found primarily in eukaryotes and archaea, but the bacterial homologs are distinct, having aparrently diverged after being laterally transferred from an early eukaryote. HMG-CoA synthase is the first step in the pathway and joins acetyl-CoA with acetoacetyl-CoA with the release of one molecule of CoA. The Borellia sequence may have resulted from a separate lateral transfer event.
Statistics
?
PSSM-Id: 213655
View PSSM: TIGR01835
Aligned: 7 rows
Threshold Bit Score: 549.35
Threshold Setting Gi: 15595028
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3V4X_A         8 IGIDKISFFVPPYYIDMTALAE-----ARNVDPGKFHIGIG---QDQMAVNPISQDIVTFAANAAEAILTKE--DKEAID 77  Enterococcus fa...
CAD24420       9 TGIEAISFYTPQNYVGLDILAA-----HHGIDPEKFSKGIG---QEKIALPGHDEDIVTMAAEAALPIIERA--GTQGID 78  Paracoccus zeax...
WP_002382275  59 IGIDKISFFVPPYYIDMTALAE-----ARNVDPGKFHIGIG---QDQMAVNPISQDIVTFAANAAEAILTKE--DKEAID 128 Enterococcus fa...
WP_011066640   3 IGIDKIGFYAPHLYLDMNELAE-----ERGVEPEKFTIGIG---QEKMAVPPITQDTVTLAANAAAQILDET--DKQDID 72  Oceanobacillus ...
WP_000998532  11 IGIDKIGFATSQYVLKLQDLAE-----ARGIDPEKLSKGLL---LKELSIAPLTEDIVTLAASASDSILTEQ--ERQEVD 80  Streptococcus p...
WP_010889798   3 IGISDIRIFLPLNYLDFSVLLEnplyfSNEVFFKKINRAIDatlQKGFRFTSPNEDSVTMASSAVKLIFDNNnlDLSKIR 82  Lyme disease sp...
BAB07795       5 IGIHDLSFATTEFVLPHTALAE-----YNGTEIGKYHVGIG---QQSMSVPAADEDIVTMAATAARPIIERN--GKSRIR 74  Streptomyces sp...
3V4X_A        78 MVIVGTESSIDESKAAAVVLHRLMGIQPFAR-----SFEIKEACYGATAGLQLAKNHVALHPD-KKVLVVAADIAKYGLN 151 Enterococcus fa...
CAD24420      79 TVLFATESGIDQSKAAAIYLRRLLDLSPNCR-----CVELKQACYSATAALQMACAHVARKPD-RKVLVIASDVARYDRE 152 Paracoccus zeax...
WP_002382275 129 MVIVGTESSIDESKAAAVVLHRLMGIQPFAR-----SFEIKEACYGATAGLQLAKNHVALHPD-KKVLVVAADIAKYGLN 202 Enterococcus fa...
WP_011066640  73 MVIFGTESGIDHSKSAAVNVHQLLGLQPHAR-----AIELKQACYGATAGIQMARGHIALNPN-RKVLVLGSDIARYGLR 146 Oceanobacillus ...
WP_000998532  81 MVIVATESGIDQSKAAAVFVHGLLGIQPFAR-----SFEIKEACYGATAALHYAKLHVENSPE-SKVLVIASDIAKYGIE 154 Streptococcus p...
WP_010889798  83 ILLGGTETGVDHSKAISSYVFGALKQSGICLgnnflTFQVQHACAGAAMSLHTVASVLSHSNNsEYGIVFSSDIAHYSNL 162 Lyme disease sp...
BAB07795      75 TVVFATESSIDQAKAGGVYVHSLLGLESACR-----VVELKQACYGATAALQFAIGLVRRDPA-QQVLVIASDVSKYELD 148 Streptomyces sp...
3V4X_A       152 SGGEPTQGAGAVAMLVSSEPRILALKEDNV-MLTQDIYDFWRPTGHPYPMVDGPLSNETYIQSFAQVWDEHKKRTGLDFA 230 Enterococcus fa...
CAD24420     153 SSGEATQGAGAVAILVSADPKVAEIGTVSG-LFTEDIMDFWRPNHRRTPLFDGKASTLRYLNALVEAWNDYRANGGHEFA 231 Paracoccus zeax...
WP_002382275 203 SGGEPTQGAGAVAMLVASEPRILALKEDNV-MLTQDIYDFWRPTGHPYPMVDGPLSNETYIQSFAQVWDEHKKRTGLDFA 281 Enterococcus fa...
WP_011066640 147 TPGESTQGAGAVALLISADPSIMAIEQEST-YYTDDIMDFWRPVYSDIAFVDGKYSNEQYIAFFQKVWNAYKEQTNRGLE 225 Oceanobacillus ...
WP_000998532 155 TPGEPTQGAGSVAMLITQNPRMMAFNNDNV-AQTRDIMDFWRPNYSTTPYVNGVYSTQQYLDSLKTTWLEYQKRYQLTLD 233 Streptococcus p...
WP_010889798 163 TTAEITQGAGATAILIEKNPKLLSINLSEFgVYTDDVDDFFRPFGSVEAKVRGQYSVECYNNANENALRDFAFKKQLSMK 242 Lyme disease sp...
BAB07795     149 SPGEATQGAAAVAMLVGADPALLRIEEPSG-LFTADVMDFWRPNYLTTALVDGQESINAYLQAVEGAWKDYAEQDGRSLE 227 Streptomyces sp...
3V4X_A       231 DYDA---LAFHIPYTKMGKKALLAKISDQTEAE-Q-ERILARYeesiIYSR------RVGNLYTGSLYLGLISLLENAt- 298 Enterococcus fa...
CAD24420     232 DFAH---FCYHVPFSRMGEKANSHLAKANKTPV-DmGQVQTGL----IYNR------QVGNCYTGSIYLAFASLLENAq- 296 Paracoccus zeax...
WP_002382275 282 DYDA---LAFHIPYTKMGKKALLAKISDQTEAE-Q-ERILARYeesiVYSR------RVGNLYTGSLYLGLISLLENAt- 349 Enterococcus fa...
WP_011066640 226 DFAA---ICFHLPYTKMGLKALRTVLDEVEENT-Q-THLKEQYrlstQYNR------NIGNIYTGSLYLSLLSLLENSn- 293 Oceanobacillus ...
WP_000998532 234 DFAA---VCFHLPYPKLALKGLKKIMDKSLPQEkK-DLLQKHFdqsiLYSQ------KVGNIYTGSLFLGLLSLLENTd- 302 Streptococcus p...
WP_010889798 243 DLFSnyrFVLHVPFAKMPIDSMHYILKKYYSD--D-ESVRNAYlesiDFYDgveaamEVGNLYTGSIFLSLAFYLKRVfs 319 Lyme disease sp...
BAB07795     228 EFAA---FVYHQPFTKMAYKAHRHLLNFNGYDT-DkDAIEGALgqttAYNN------VIGNSYTASVYLGLAALLDQA-- 295 Streptomyces sp...
3V4X_A       299 -TLTAGNQIGLFSYGSGAVAEFFTGELVAGYQNHLQKETHLALLDNRTELSIAEYEAMFAETLDTDId----QTLEDELK 373 Enterococcus fa...
CAD24420     297 -EDLTGALVGLFSYGSGATGEFFDARIAPGYRDHLFAERHRELLQDRTPVTYDEYVALWDEIDLTQG-----APDKARGR 370 Paracoccus zeax...
WP_002382275 350 -TLTAGNQIGLFSYGSGAVAEFFTGELVAGYQNHLQKETHLALLDNRTELSIAEYEAMFAETLDTDId----QTLEDELK 424 Enterococcus fa...
WP_011066640 294 -ELTAGDKIGMYSYGSGAVGEFFSGVLQEGFEKQLHQTKHNAMFEKRQKISVSEYEKIFEQQIPTDGsvtewSTKEDPAE 372 Oceanobacillus ...
WP_000998532 303 -SLKAGDKIALYSYGSGAVAEFFSGELVEGYEAYLDKDR-LNKLNQRTALSVADYEKVFFEEVNLDEtnsaqFAGYENQD 380 Streptococcus p...
WP_010889798 320 kKDITGEKILFCSYGSGNIMIIYELTIEKSAFDVIKLWDLEGLIKNRNNANFEEYKDFFQNKII---------PGESRGF 390 Lyme disease sp...
BAB07795     296 -DDLTGRSIGFLSYGSGSVAEFFSGTVVAGYRERLRTEANQEAIARRKSVDYATYRELHEYTLPSDGgd-haTPVQTTGP 373 Streptomyces sp...
3V4X_A       374 YSISAINNTVRSY 386 Enterococcus faecalis
CAD24420     371 FRLAGIEDEKRIY 383 Paracoccus zeaxanthinifaciens
WP_002382275 425 YSISAINNTVRSY 437 Enterococcus faecalis
WP_011066640 373 ICLTGIQNHQRIY 385 Oceanobacillus iheyensis
WP_000998532 381 FALVEILDHQRRY 393 Streptococcus pneumoniae
WP_010889798 391 YLKELRNDGYRVY 403 Lyme disease spirochete
BAB07795     374 FRLAGINDHKRIY 386 Streptomyces sp. CL190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap