2WYA,2P8U,2F82


Conserved Protein Domain Family
HMG-CoA-S_euk

?
TIGR01833: HMG-CoA-S_euk 
Click on image for an interactive view with Cn3D
3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade
Hydroxymethylglutaryl(HMG)-CoA synthase is the first step of isopentenyl pyrophosphate (IPP) biosynthesis via the mevalonate pathway. This pathway is found mainly in eukaryotes, but also in archaea and some bacteria. This model is specific for eukaryotes.
Statistics
?
PSSM-Id: 273826
View PSSM: TIGR01833
Aligned: 10 rows
Threshold Bit Score: 790.507
Threshold Setting Gi: 112490556
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WYA_A   2 MPKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEV 81  human
P54961   2 WPSDVGIVALELIFPSQYVDQVDLEVYDNVSAGKYTVGLGQARMGFCTDREDINSLCLTVVSRLMERWSIPYSQIGRLEV 81  German cockroach
P54870   4 WPEDVGIIGIEMIFPSLYVDQAELETYDEVSPGKYTMGLGQDKMGVCTDREDINSLCLTAVDKLMERNNIDYNDIGWLEV 83  German cockroach
P54868  50 WPKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEV 129 human
P54873   1 MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVTSLFEKYKIDPNQIGRLEV 80  thale cress
P54874   4 DRKDIGIKGLVLYTPNQYVEQAALEAHDGVSTGKYTIGLGLTKMAFVDDREDIYSFGLTALSQLIKRYQIDISKIGRLEV 83  Schizosaccharomyces p...
P54839  45 RPQNVGIKGIQIYIPTQCVNQSELEKFDGVSQGKYTIGLGQTNMSFVNDREDIYSMSLTVLSKLIKSYNIDTNKIGRLEV 124 Saccharomyces cerevis...
P23228  13 WPKDVGIVALEIYFPSQYVDQTELEKYDGVDAGKYTIGLGQSKMGFCSDREDINSLCLTVVQKLMERNSLSYDCIGRLEV 92  chicken
2P8U_A  21 qsmDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSLCMTVVQNLMERNNLSYDCIGRLEV 100 human
2F82_A   1 -AKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVTSLLEKYKIDPKQIGRLEV 79  Brassica juncea
2WYA_A  82 GTETIIDKSKAVKTVLMELFQDsgNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTG 161 human
P54961  82 GTETLLDKSKSVKTVLMQLFKD--NTDIEGVDTVNACYGGTSALFNAISWVESSSWDGRYALVVAGDIAVYAKGSARPTG 159 German cockroach
P54870  84 GTETILDKVKSVKTVLMQLFEEsgNTDVEGIDTINACYRGTAALFNALIWIESSSWDGRYAIVVAADIAIYAK-ECSPTG 162 German cockroach
P54868 130 GTETIIDKSKAVKTVLMELFQDsgNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTG 209 human
P54873  81 GSETVIDKSKSIKTFLMQLFEKcgNTDVEGVDSTNACYGGTAALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTG 160 thale cress
P54874  84 GTETIIDKSKSVKSVLMQLFGD--NHNVEGIDCVNACYGGVNALFNTIDWIESSAWDGRDGIVVAGDIALYAKGNARPTG 161 Schizosaccharomyces p...
P54839 125 GTETLIDKSKSVKSVLMQLFGE--NTDVEGIDTLNACYGGTNALFNSLNWIESNAWDGRDAIVVCGDIAIYDKGAARPTG 202 Saccharomyces cerevis...
P23228  93 GTETIIDKSKSVKTVLMQLFEEsgNTDVEGIDTTNACYGGTAALFNAINWIESSSWDGRYALVVAGDIAVYATGNARPTG 172 chicken
2P8U_A 101 GTETIIDKSKSVKTNLMQLFEEsgNTDIEGIDTTNAXYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTG 180 human
2F82_A  80 GSETVIDKSKSIKTFLMQLFEKcgNTDVEGVDSTNACYGGTAALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTG 159 Brassica juncea
2WYA_A 162 GAGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKqag---s 238 human
P54961 160 GAGAVAMLVGANAPLVFDRGVRSSHMQHAYDFYKPDLSSLYPTVDGKLSIQCYLSALDHCYQLYCSKIQKQLG------- 232 German cockroach
P54870 163 GAGALLMLIGANAPIVIDRGVRASHMKHAYDFYKPDLMSEYPVVDGKLSVQCYLSALDHCYPRFCSKTEKYLKrcg--ke 240 German cockroach
P54868 210 GAGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKqag---s 286 human
P54873 161 GAAAIAMLIGPDAPIVFESKLRASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEG------- 233 thale cress
P54874 162 GAGCVALLVGPNAPIVFEPGLRGTYMQHAYDFYKPDLTSEYPYVDGHFSLECYVKALDGAYANYNVRDVAKNGksq---- 237 Schizosaccharomyces p...
P54839 203 GAGTVAMWIGPDAPIVFDS-VRASYMEHAYDFYKPDFTSEYPYVDGHFSLTCYVKALDQVYKSYSKKAISKGLvsdpags 281 Saccharomyces cerevis...
P23228 173 GAGAVAMLVGSNAPLIFERGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIHAQWQkeg---t 249 chicken
2P8U_A 181 GVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYSVYCKKIHAQWQkeg---n 257 human
2F82_A 160 GAAAIAMLIGPDAPIVFESKLRGSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGk------ 233 Brassica juncea
2WYA_A 239 dRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSD-TQTsLYKGLEAFGGLKLEDTYTNKDLDKALLKASQDMFD 317 human
P54961 233 -EKFDIERLDAVLFHAPYCKLVQKSLARLVLNDFVRASEEeRTT-KYSSLEALKGVKLEDTYFDREVEKAVMTYSKNMFE 310 German cockroach
P54870 241 nTKIDLDYFDAFVFHSPYCKLVQKSVARLVLNDFIQYPE------KYQDLQQLRNLKFEDTYFDRDIEKIFMDKSKQLFE 314 German cockroach
P54868 287 dRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLS-ASSdTQTsLYKGLEAFGGLKLEDTYTNKDLDKALLKASQDMFD 365 human
P54873 234 -KEFSINDADYIVFHSPYNKLVQKSFARLLYNDFLRNASS-IDEaAKEKFTPYSSLTLDESYQSRDLEKVSQQIAKPFYD 311 thale cress
P54874 238 --glgLDRFDYCIFHAPTCKQVQKAYARLLYTDSAAEPSN---PeLEGVRELLSTLDAKKSLTDKALEKGLMAITKERFN 312 Schizosaccharomyces p...
P54839 282 dALNVLKYFDYNVFHVPTCKLVTKSYGRLLYNDFRANP-----QlFPEVDAELATRDYDESLTDKNIEKTFVNVAKPFHK 356 Saccharomyces cerevis...
P23228 250 dRGFTLNDFGFMIFHSPYCKLVQKSVARLLLNDFLSDQNAeTANgVFSGLEAFRDVKLEDTYFDRDVEKAFMKASAELFN 329 chicken
2P8U_A 258 dKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNR-DKNsIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFS 336 human
2F82_A 234 --EFSINDADYFVFHSPYNKLVQKSFARLLYNDFLRNASS-IDEaAKEKFTPYSSLSLDESYQSRDLEKVSQQLAKTYYD 310 Brassica juncea
2WYA_A 318 KKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDL 397 human
P54961 311 EKTKPSLLLANQVGNMYTPSLYGGLVSLLVSKSAQELAGKRVALFSYGSGLASSMFSLRISSDASAKSSLQRLVSNLSHI 390 German cockroach
P54870 315 KKTKPSLMLANQVGNMYTTSLYGGLVSLLISEDIGELAGKCICMFSYGSGFAASMFSLHISTDSSPGSTLSRLVTNLTHI 394 German cockroach
P54868 366 KKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDL 445 human
P54873 312 AKVQPTTLIPKEVGNMYTASLYAAFASLIHKKHN-DLAGKRVVMFSYGSGSTATMFSLRLNDNKPPFSISN--IASVMDV 388 thale cress
P54874 313 KRVSPSVYAPTNCGNMYTASIFSCLTALLSRVPADELKGKRVGAYSYGSGLAASFFSFVVKGD-------VSEIAKKTNL 385 Schizosaccharomyces p...
P54839 357 ERVAQSLIVPTNTGNMYTASVYAAFASLLNYVGSDDLQGKRVGLFSYGSGLAASLYSCKIVGD-------VQHIIKELDI 429 Saccharomyces cerevis...
P23228 330 QKTKASLLVSNQNGNMYTPSVYGCLASLLAQYSPEHLAGQRISEFSYGSGFAATLYSIRVTQDATPGSALDKITASLSDL 409 chicken
2P8U_A 337 QKTKASLLVSNQNGNMYTSSVYGSLASVLAQYSPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDL 416 human
2F82_A 311 AKVQPTTLVPKQVGNMYTASLYAAFASLVHNKHS-DLAGKRVVMFSYGSGSTATMFSLRLCENQSPFSLSN--IASVMDV 387 Brassica juncea
2WYA_A 398 PKRLASRKCVSPEEFTEIMNQREQFYHKVNFSP--PGDTNSLFPGTWYLERVDEQHRRKYARR 458 human
P54961 391 KPQLDLRHKVSPEEFAQTMETREHNHHKAPYTP--EGSIDVLFPGTWYLESVDSLYRRSYKQV 451 German cockroach
P54870 395 KPQVQQRVKLSPGEFENIMEIREQNHHKAPYTP--VASPNTLFPGTWYLESIDSMHRRKYKRV 455 German cockroach
P54868 446 PKRLASRKCVSPEEFTEIMNQREQFYHKVNFSP--PGDTNSLFPGTWYLERVDEQHRRKYARR 506 human
P54873 389 GGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTtkEGIIDLLAPGTYYLKEVDSLYRRFYGKK 451 thale cress
P54874 386 VNDLDNRHCLTPTQYEEAIELRHQAHLKKNFTP--KGSIERLRSGTYYLTGIDDMFRRSYSVK 446 Schizosaccharomyces pombe 972h-
P54839 430 TNKLAKRITETPKDYEAAIELRENAHLKKNFKP--QGSIEHLQSGVYYLTNIDDKFRRSYDVK 490 Saccharomyces cerevisiae S288c
P23228 410 KARLDSRKCIAPDVFAENMKIRQETHHLANYIP--QCSVEDLFEGTWYLVRVDEKHRRTYARR 470 chicken
2P8U_A 417 KSRLDSRTGVAPDVFAENMKLREDTHHLVNYIP--QGSIDSLFEGTWYLVRVDEKHRRTYARR 477 human
2F82_A 388 GGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTskEGILDLLAPGTYYLKEVDSLYRRFYGKK 450 Brassica juncea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap