Conserved Protein Domain Family
GPH_sucrose

?
TIGR01301: GPH_sucrose 
GPH family sucrose/H+ symporter
This model represents sucrose/proton symporters, found in plants, from the Glycoside-Pentoside-Hexuronide (GPH)/cation symporter family. These proteins are predicted to have 12 transmembrane domains. Members may export sucrose (e.g. SUT1, SUT4) from green parts to the phloem for long-distance transport or import sucrose (e.g SUT2) to sucrose sinks such as the tap root of the carrot.
Statistics
?
PSSM-Id: 273545
View PSSM: TIGR01301
Aligned: 5 rows
Threshold Bit Score: 772.822
Threshold Setting Gi: 7024413
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

TIGR01301 is the only member of the superfamily cl26211
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4960089  21 PPRWKIVMVASIAAGVQFGWALQLSLLTPYLQLLGIPHRYASIIWLCGPISGMIVQPAVGYLSDNLS---STFGRRRPFI 97
gi 5230818  33 SPLRKIMVVASIAAGVQFGWALQLSLLTPYVQLLGIHHTWAAYIWLCGPISGMLVQPVVGYHSDRCT---SRFGRRRPFI 109
gi 667047   19 IPVWKFVLVASLAAGIQFGWALQLSLLTPYIQMLGLPHGAASFIWLCGPVSGLLVQPLAGYFSDRCK---SRFGRRRPFI 95
gi 2969887  25 VSLRLLLRVASVACGIQFGWALQLSLLTPYVQELGIPHAWSSIIWLCGPLSGLLVQPIVGHMSDQCT---SKYGRRRPFI 101
gi 7024413  25 VPLRSLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWLCGPLSGLLVQPLVGHLSDRITpanSPLGRRRPFI 104
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4960089  98 AAGSSLVAVAVIFIGFAADIGHAFGDPL-DTKTKPLGIITFIVGFWYLDVANNMLQGPCRAFLADLSGGKACRIRTGQSC 176
gi 5230818 110 AAGSIAVAIAVFLIGYAADLGHSFGDNL-DKKVRPRAIGIFVVGFWILDVANNMLQGPCRALLGDLCAGNQRKTRNANAF 188
gi 667047   96 MSGACLVAAAVILIGFAADIGHSAGDDM-TKKTKPRAVVVFVVGFWILDVANNMLQGPCRAFLADLSAGDEKKMTHAMSF 174
gi 2969887 102 VAGGTAIILAVIIIAHSADIGGLLGDT---ADNKTMAIVAFVIGFWILDVANNMTQGPCRALLADLTGNDARRTRVANAY 178
gi 7024413 105 AAGAASIAFAVLTVGFSADLGRLFGDNVvPGSTRIGAIIVYLVGFWLLDVGNNATQGPCRAFLADLTENDPRRTRIANAY 184
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4960089 177 YAFFMAVGSILGNAAGSYSHLYTIFPFTKTEACGVQCANLKSCFLISVVLLLTLTTLALTAVDEKVLPQKDHFIN-Seyl 255
gi 5230818 189 FSFFMAVGNVLGYAAGAYSKLYHVFPFTKTEACNVYCANLKSCFFLSIALLTVLATAALIYVKETPLIAEKAVVTaE--- 265
gi 667047  175 FAFFMGIGNVLGYAAGSYNNLHRLLPFTRTDACEIFCANLKTCFLIHICLLMCLTITALSVVKEPLVNVVDD-------- 246
gi 2969887 179 FSLFMAIGNVLGYATGAYSGWYKVFPFSLTSSCTINCANLKSAFYIDIIFIIITTYISISAAKERPRISSQDGPQfSedg 258
gi 7024413 185 FSLFMALGNILGYATGAYNGWYKIFPFTITGSCGVSCANLNSAFLLDIIILAITTYISVATVQDNPTFGSDea------- 257
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4960089 256 gSSGKKGGLLFFGEMFEALKHLPRSVWILLMVTAVNWIAWFPFTLYGTDWMGKEVYGGRVRDGN---LYNKGVHAGVFGL 332
gi 5230818 266 -DGGSNGGMPCFGQLSGAFKELKRPMWILLLVTCLNWIAWFPFLLFDTDWMGKEVYGGTVGEGH---AYDMGVRAGALGL 341
gi 667047  247 --ERKGGSLMVFVELFGALKNLSKPMWILMLVTCLNWIAWFPFLLYDTDWMGREVYGGKVNQS----VYDMGVRAGAIGL 320
gi 2969887 259 tAQSGHIEEAFLWELFGTFRLLPGSVWVILLVTCLNWIGWFPFILFDTDWMGREIYGGEPNQGQ---SYSDGVRMGAFGL 335
gi 7024413 258 aPPSSHEEEAFLFELFGSFKYFTMPVWMVLIVTSLTWVGWFLFILFDTDWMGREIYRGSPEIVAdtqKYHDGVRMGSFGL 337
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4960089 333 LLSSVVLCLMSLGVECVGKWLGGAKRLWGIVNFILAICLAMTVFVTKMADKSRRYDG--DG--ELLPPDQGVKISALLLN 408
gi 5230818 342 MLNSVVLGATSLGVDILARGVGGVKRLWGIVNFLLAICLGLTVLVTKLAQHSRQYAPgtGGlqDPLPPSGGIKAGALTLF 421
gi 667047  321 MLNSVVLGITSILLYFFSKGAKAAKTWWLGVNIVLAVGLAGTVWVSYHAKSVRQLGa--SG--EALPPSFEVKASALAIF 396
gi 2969887 336 MMNSVVLGITSVLMEKLCRIWGSG-FMWGLSNILMTICFFAMLLITFIAKNMDY---------GTNPPPNGIVISALIVF 405
gi 7024413 338 MLNSVVLGITSIGMEKLCRKWGAG-LVWGVSNIIMALCFVAMLIITYVAQNLDYG--------PSGAPPTGIVAASLIVF 408
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4960089 409 AVTGIPLAVLYSIPFAMASIYSS----NVGAGQGLSQGVINLAIVVPQTLVSISGRPFDALFGGGNLPAFVAGAVAAAVS 484
gi 5230818 422 SVLGIPLAITYSIPFALASIFSS----TSGAGQGLSLGVLNLAIVIPQMFVSVLSGPWDALFGGGNLPAFVVGAVAALAS 497
gi 667047  397 AILGIPLAVTFSVPFALAAIYCSrntnTGGAGQGLSLGVMNLSIVIPQIIVSLSSGPLDKAFGGGNLPAFIMGAVGAVFS 476
gi 2969887 406 AILGIPLAITYSVPYALVSTRIE----SLGLGQGLSMGVLNLAIVVPQVIVSLGSGPWDQLFGGGNSPAFVVAALSAFAA 481
gi 7024413 409 TILGAPLSITYSIPYAMAASRVE----NLGLGQGLAMGILNLSIVIPQIIVSLGSGPWDQLFGGGNAPSFWVAAAASFVG 484
                      490
               ....*....|....
gi 4960089 485 GILALTLLPSPTEP 498
gi 5230818 498 GILSMILLPSPPPD 511
gi 667047  477 GVLAFILLPAPKVD 490
gi 2969887 482 GLIALIAIRRPRVD 495
gi 7024413 485 GLVAILGLPRARLG 498
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap